KEGG   Hevea brasiliensis (rubber tree): 110645553Help
Entry
110645553         CDS       T05150                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00010  Glycolysis / Gluconeogenesis
hbr00562  Inositol phosphate metabolism
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110645553
   00562 Inositol phosphate metabolism
    110645553
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110645553
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110645553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110645553
NCBI-ProteinID: XP_021654452
Position
Unknown
AA seq 506 aa AA seqDB search
MPVCSKREKMKPSTAAISFVLFWFSMLLHSIADQAFDVRQHLSTVTRYGAVKDVGNSSSL
QFSIHEGCTPIHLNLVARHGTRSPTKKRMRELNLLASHLEELIRDAKEQKLSLQKVPTWL
QGWKSPWRGKLKGGDLISKGEDELYDLGIRIRKRFPDLFKEEYHPDVYPIKATQVPRASA
SAVAFGMGLFSEKGSLGPGHHQAFAVSSESRASDIMLRFHDCCENYKAFRKSQEPAVDNL
KEPILDEITATLVSRYELNFTRQDTSSLWFLCKQEASLLDITDQACGLFNPSEVALLEWT
DDLEMFILKGYGKSINYRMGVPLLKDVVQSMEQAIKAQEEQLAPGSYEKARLRFAHAETL
VPFTCLLGLFLEQSEFEKIQREQPLELPPRPPHSRNWWGSMVAPFAGNNLLVLHSCPANP
SSKYFIQVLHNERPITMPGCNNSDFCPFEEFKDMIVGPHLKHDYNTICAKKLEQPEQKFE
TSKLLLLFHWLFSLGRDETQSTKADL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgccggtttgttctaagagagagaaaatgaagccctccacggctgccatctcctttgtt
cttttctggttttcaatgctcttgcattctattgccgatcaagccttcgatgtccgtcaa
cacctctccaccgtaacaagatatggtgctgtgaaagatgtgggtaatagttcctcttta
cagtttagtattcatgagggatgcactcctatccacttaaaccttgtggcaagacatgga
actcggtctccaaccaaaaaacggatgagagagttgaacctgttggcatctcatttggaa
gaactcataagagatgccaaggaacagaaattatctttgcagaaagttccgacctggtta
cagggttggaaatctccttggagaggcaaattaaaaggtggagatttgattagcaaagga
gaagatgaattatatgatcttggaatcaggattaggaaaagatttccagatttgttcaag
gaggaatatcaccctgatgtgtatcctataaaggctacccaggttcctcgagcgtcagct
agtgccgtggcatttggcatggggctgtttagtgagaagggaagccttggaccagggcat
catcaagcttttgcagtcagcagtgaaagccgtgcaagtgatataatgcttaggtttcat
gattgttgtgaaaattacaaggcttttaggaaaagccaagagccagctgttgataacctt
aaggaacctattttagatgaaattacagctacattagtgagccgttatgagcttaatttt
acaagacaagacacttcttctctatggtttctctgtaaacaggaagcatccttgttggat
ataacagatcaagcgtgtggtctattcaatccttctgaggtggctttgctggaatggaca
gatgacttggagatgtttatattgaagggttatggtaaatcaataaactatcgaatggga
gtgccattgcttaaagatgttgttcagtccatggagcaagctattaaggcacaagaagaa
caacttgctcctggaagttacgagaaggcaagactacggtttgcacatgcagagacgctg
gttcctttcacatgtctacttggtcttttccttgaacaatcagaatttgaaaaaatacag
agagaacaacctttggaacttcctccaaggcctccccacagtagaaattggtggggcagc
atggtagcaccttttgctggcaacaacttactggtccttcacagttgtccagcaaatcct
tcaagcaagtacttcatccaagtactccacaatgaacgtcccattacaatgccaggttgc
aataattctgatttctgtccatttgaagagtttaaggacatgatagttggtcctcattta
aagcatgactataatacaatctgcgctaagaaactggaacaaccagagcagaagtttgaa
actagtaagttattgctactgtttcattggctcttctcattggggagagatgagacacag
tctaccaaagctgatttatag

DBGET integrated database retrieval system