KEGG   Hevea brasiliensis (rubber tree): 110646012Help
Entry
110646012         CDS       T05150                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)-like
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00010  Glycolysis / Gluconeogenesis
hbr00020  Citrate cycle (TCA cycle)
hbr00620  Pyruvate metabolism
hbr00710  Carbon fixation in photosynthetic organisms
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01200  Carbon metabolism
Module
hbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
hbr_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110646012
   00020 Citrate cycle (TCA cycle)
    110646012
   00620 Pyruvate metabolism
    110646012
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110646012
Enzymes [BR:hbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     110646012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-GeneID: 110646012
NCBI-ProteinID: XP_021654987
Position
Unknown
AA seq 656 aa AA seqDB search
MATNGEVKINGNGTATQKSPLRKITTSDKHDGICHDMSAPTVKAQTIDELHSLQKKKSAP
STPNKGIQGAFAAVSEEERQKQQLQSISASLASLTRETGPKVVRGDPANKIQPISKDHHV
TAPISVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRAPRDKR
VVKDDDTSEELWWGKGSPNIEMDEHTFMVNRERAVDYLNSLDKVFVNDQFLNWDPENRIK
VRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLN
LARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGK
TTLSTDPNRYLIGDDEHCWTETGVSNIEGGCYAKCIDLSKEKEPDIWNAIKFGTVLENVV
FDEHTREVDYVDRSVTENTRASYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKL
NLAQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQKHGA
TGWLVNTGWSGGSYGSGSRIKLAYTRKIIDAIHSGSLLKANYKKTKVFGLEIPTEVEGVP
SEILDPVNTWSDKKAYTETLLKLAGLFQNNFTTFTDYKIGKDNKLTEEILAAGPIF
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaacggagaggtgaagattaatgggaatggaacggcgacccagaagtcacct
ttgaggaagatcacgacgagcgacaaacatgacgggatctgccacgatatgagcgcaccc
accgtgaaggctcagaccatcgacgagcttcactctcttcagaagaagaaatctgcgcct
tccactcctaataaagggattcagggtgccttcgccgctgtctctgaagaagaacgccaa
aaacagcagctccagtccatcagtgcatctttggcatcgctgacaagagaaaccggaccc
aaggtggtgagaggagacccggctaacaagatccagcccatttcaaaagatcaccacgtc
actgcacccatcagcgtcagtgatagctccttaaaattcactcatgttctttacaatctc
tcacctgctgagctttatgagcaggccataaagtacgagaaagggtcttttattacgtct
actggtgcattggccaccctctctggtgctaagactggccgggctcccagagataagcgt
gttgtcaaggatgatgacacaagcgaggagctttggtggggaaagggctcacctaatatt
gaaatggacgagcacactttcatggttaacagggaacgagctgttgattacttgaattct
ttggataaggtctttgtaaatgatcaattcttgaactgggaccctgagaacagaatcaaa
gttcggattgtctctgccagagcttaccattcattgttcatgcacaacatgtgtatccga
cccactcctgaagagctggagaattttggtactccggacttcactatatacaatgctggt
cagttcccatgtaatcgttacacacactacatgacatcttctactagcatagatttgaat
ttagctagaagggaaatggtcatcctcggcacacagtacgccggggaaatgaagaagggt
ctattcagtgttatgcattatctcatgcctaagcgccaaatcctctccttacattctggc
tgcaatatgggaaaagatggagatgttgccctcttctttggattgtcaggtactggaaag
acaactttgtctacagatccaaataggtacctaattggagatgatgaacattgctggact
gagactggagtgtcaaatattgaaggggggtgctatgccaaatgcattgatctctcaaag
gagaaggagcctgatatctggaatgccatcaagtttggaactgttttggaaaatgtggta
tttgatgagcacactcgtgaggtggactatgttgacagatcagttacagagaatactcga
gcatcttaccctattgagtatattcctaatgcaaagataccctgtgttggtccacacccc
aagaatgtaatccttttggcatgcgatgcatttggtgtgcttccacctgtgagcaagctg
aacctggctcagactatgtaccatttcataagtggttacactgcactggtggctggcact
gaagagggtgtgaaagaaccccgggcaacattctcagcctgctttggtgcagcatttata
atgttgcaccctaccaaatatgcagctatgctggctgagaagatgcagaagcatggtgca
acaggatggcttgtcaacactggctggtccggtggaagctatgggtcaggcagccgtatc
aagttagcatacacaaggaaaatcattgatgccatacactctggcagcctcctgaaggca
aattacaagaaaactaaagtgtttgggcttgagatccccacagaggtcgaaggagtgcct
tctgaaatcctggatcctgtgaacacttggtcagacaagaaagcttacactgagacactg
ttgaaactggctggtctgttccagaacaactttacaactttcaccgactacaagattgga
aaggacaacaagctgactgaggagatcctagcagctggtccgatattttaa

DBGET integrated database retrieval system