KEGG   Hevea brasiliensis (rubber tree): 110646592Help
Entry
110646592         CDS       T05150                                 

Definition
(RefSeq) lysM domain receptor-like kinase 3
Organism
hbr  Hevea brasiliensis (rubber tree)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 110646592
NCBI-ProteinID: XP_021655771
Position
Unknown
AA seq 419 aa AA seqDB search
MCKSRKAIDVTQSLTPKSHPSKSSSKSLSSSSGNYPLSSSINYSSSGFFNHNKDTSKSSS
SSISSKRFLKILKEASLPENTKIYDFVEICRATNNFLSKPLSSSSSSTSWRCQIRRKEVI
IVQRKFRHRDPLKLPELQQRLSTICRSHHSSLIKLLGAATSGNYIYLVYEYFHGTSLATC
LRNPQNPNYTVLSNWLSRMHIATDIAHGIDYIHHCADSNSGFVHNHIKSSSILVAEDLLD
AKICHFGAAELCGEIEGSERSEARSFGRSNSKGKKIEGTRGYMSPEFQASGVVTQKCDVY
AFGMVVLELVSGEEALNYVFDEGRGEFSRVGVIERAREAVGSGGGGVRSWVDRRLKDSYP
VDVAEKMVVVGLDCVEDDPEKRPDMEQVAVRVSKLYLESKNWAEKIGMPIDFSVSLAPR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaatcaagaaaagccatagacgtaacccaatctcttaccccaaaatcccaccct
tcaaaatcttcatcaaagtcattatcatcatcatccggcaattacccattatcatcatcc
attaattactcttcttcaggcttctttaaccataataaggacacttcaaaatcatcttct
tcttccatctcaagcaaacgctttctcaaaatccttaaagaagcttctttaccagagaat
acaaaaatttatgactttgttgaaatatgcagagccaccaacaacttcctatcaaaaccc
ttatcttcctcttcctcttccacctcttggcgctgccagattcgccggaaagaggttatt
attgtccagcgcaagttccgccaccgtgaccccttaaaattaccggagctccagcaacgg
ttatccaccatctgcaggagtcatcatagtagcttgattaagcttctgggcgcggccact
tcagggaattatatatatcttgtgtacgaatactttcatggaaccagtttagctacttgt
cttagaaacccacagaatcccaattacacggtactttcaaattggctctcgcggatgcat
attgctacagatatcgctcatgggatcgattacattcatcattgtgcagattcaaattca
ggctttgtgcataaccatataaagagttcgagcattttagtagctgaagatttgttggat
gccaagatttgtcatttcggggcagcggagctatgcggggaaatagagggaagtgaaaga
tctgaggcaagaagttttggcaggagtaatagtaaaggcaagaaaattgaagggacaaga
ggatacatgtcgccggagtttcaagcaagtggggttgtgacgcagaaatgcgatgtttat
gcttttgggatggtggttttggagctggtgtcaggagaggaggcgttgaattatgtgttt
gatgaagggagaggagagtttagcagagttggtgtgatagagagggcaagagaggcagtg
ggtagcggtggcggtggggtgaggagctgggttgataggaggttgaaggattcgtatcca
gtggatgtggcagagaagatggtggtggtggggttggattgtgtggaggatgatccagag
aagcggccagatatggagcaggtggctgttagagtgtcaaaattgtatttggaatccaag
aactgggctgagaagattggtatgccaattgatttctctgtttctttggcgcctcgatga

DBGET integrated database retrieval system