KEGG   Hevea brasiliensis (rubber tree): 110646762Help
Entry
110646762         CDS       T05150                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 2 isoform X1
Organism
hbr  Hevea brasiliensis (rubber tree)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung APH Haspin_kinase ABC1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110646762
NCBI-ProteinID: XP_021655997
Position
Unknown
AA seq 649 aa AA seqDB search
METKMLLLYTLAITWSYNYYMVKVAKSDAGLNFLNEGCSNYNVSNFRDFSINLNNSFSDL
RTQINGGKHFATTQQFGGADSVYAMIQCRDYMSTAECLSCFTVASTKIRNCSAANGARVI
YDGCFLRYERSDFYGETTRDANREFCGNRNTSAPVTAFQTAVQGLVNDLQIATPRINGFF
AASKREVVGANNESVYGIAQCVQTIDSAGCLACMQVAFTNVQRCPPIADGRAVDSGCFMR
YSDTPFFADNQTINLEPFLKTGSSGKKTALIGGVAGGGGFLLFVVVLIVWFKHSSRKKAS
RGDILGATELRGPTNFSYKDLKSAAKNFKEENKLGEGGFGDVYKGTLKNGKIVAVKKLAL
GQSRRAKADFASEVTLISNVHHRNLVRLLGCCSKGPELLLVYEYMANSSLDRFLFGQRKG
SLVWKQRLDVIIGTAQGLAYLHEQFHVCIIHRDIKPSNILLDDDFQPKIADFGLARLLPD
DQTHLSTKFAGTLGYTAPEYAIHGQLSEKVDTYSYGVVVLEIISGRKNNETRVDPGSDYL
LKRAWRLYENGSHLELVDESLDPNEYDAKEVKRIIEIALMCTQTSPGLRPTMSEVVVLLK
SKGSLEHPPPTRPPFIDNEERVVVHGDKSTSTASSSSNATASITQVSAR
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggagacgaagatgttattgctatatacactggcaataacatggagttataattattat
atggtgaaagtcgcaaaatcagacgcaggactcaactttctaaacgaaggttgcagcaac
tacaacgtctcaaattttagagatttcagtatcaacctaaataattcttttagcgacctc
aggacgcagatcaatggcggcaagcattttgcgacgacgcagcaatttgggggcgctgat
tccgtgtatgctatgatccaatgcagagattatatgtccaccgccgaatgtctcagttgt
ttcaccgttgcttctactaaaatacgcaattgctccgccgctaatggtgctcgtgtcatt
tatgatggctgctttttaaggtatgagagaagtgacttctatggagaaaccactcgggat
gccaaccgcgagttttgtgggaatcgaaatacatcagcaccagttactgctttccaaaca
gcagtgcaaggattggtaaatgatcttcaaatcgcgacaccaaggataaatggtttcttt
gctgctagtaagagggaagttgtgggcgctaataatgaatcagtatacggcattgcacaa
tgtgttcaaaccattgattcagcaggctgcttagcttgcatgcaagtagcatttaccaac
gttcagagatgccctcctattgcagacggtagggcggtcgattctgggtgtttcatgagg
tattcggatacaccattcttcgctgataaccagactattaatcttgaacccttcttgaaa
acaggaagttctggcaaaaagacagctcttattggaggagtggctgggggtggaggcttt
cttttgtttgttgttgtgttaattgtttggtttaagcattcaagtaggaagaaagcttct
agaggtgacatattaggagcaactgaattgcgaggtcctacaaatttcagttacaaagac
ttgaaatctgcagcaaagaatttcaaagaagaaaacaaactaggagaaggaggttttggt
gatgtatacaagggtactttaaagaatgggaaaatagttgcagtaaagaaactagctcta
ggacaatcacgaagagcaaaggcagattttgcaagtgaagttacacttataagtaatgtt
catcaccggaaccttgtacgcctacttggttgttgtagcaaaggaccagaattacttctt
gtctatgaatacatggcaaacagcagccttgatagattcttatttggtcaaagaaaagga
tcccttgtttggaaacaaagattggatgtaatcattggaacagctcaaggtcttgcatat
ctacacgagcaatttcatgtatgcatcatccatcgagacatcaaaccaagcaatattctt
ttggacgatgatttccaacccaaaatagcagattttgggttggcaaggcttctgccagat
gaccaaactcatctgagcaccaaatttgctggcacattgggatacacagcacccgagtat
gcaatccatggacagttatcagaaaaggtggatacctatagctatggggtagttgtccta
gaaatcatcagtggcagaaagaacaatgagacgagagttgatcctggctctgattacctc
ctgaaaagggcatggaggctatatgagaatggctctcacctggaactggtggatgaaagc
ttagatccaaatgagtatgacgcaaaagaagtgaagagaatcatagagattgccttgatg
tgcactcaaacttcacctggcttaaggccaacaatgtctgaagtagttgttctgctcaaa
agtaagggttcactagagcatcctccaccaactaggcctccctttattgataatgaagaa
agggtggttgtccatggggacaaatccacatctaccgcatcctcttcatccaatgccact
gcttctatcacccaagtctccgctcgctaa

DBGET integrated database retrieval system