KEGG   Hevea brasiliensis (rubber tree): 110647189Help
Entry
110647189         CDS       T05150                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 1-like
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00562  Inositol phosphate metabolism
hbr01100  Metabolic pathways
hbr04070  Phosphatidylinositol signaling system
Module
hbr_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110647189
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    110647189
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     110647189
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     110647189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Motif
Other DBs
NCBI-GeneID: 110647189
NCBI-ProteinID: XP_021656593
Position
Unknown
AA seq 340 aa AA seqDB search
MSIQAKRHRIGYALAPKKVQSFIQPSLISHASRHNVDLIAIDPSKSLIEQGPFDCVIHKL
YGPDWKLQLEKFYLENPKVPIIDSPDSIERLHNRISMLEVVSRLNIPKRSQVLDVPKQVV
VLDSENLKGNGVVGEIGFPLVAKPLVADGSAKSHKMYQIFDSEGLKRLDAPIILQDFVNH
GGVIFKVYVAGDYVQCVKRKSLPDISQEKLATLKGSLSFSQISNLTVRGKNEGFGDVVDL
EKVEMPPLGFVEEIARAMRRETGLNLFNFDVIRDAKDRNRYLVIDINYFPGYAKMPNYES
VLTDFFLDLVHNNNSREMLTGNIEDGEQESYIGGLKGNND
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatccaggcgaaacggcaccgcataggctacgcactggcgccaaagaaagtgcag
agctttatccagccctcgctcattagccacgcgagtcgccacaacgtcgatctgatcgcc
atcgatccttcaaaatccctaattgaacaagggccatttgattgtgtcattcacaaattg
tatggcccagattggaagctgcaactggagaagttctatttggaaaaccctaaggttccc
attattgattctcctgattccatcgagaggctgcacaatcgaatttctatgctcgaagtt
gtcagtcggttaaatatacctaagagaagccaagtgttggatgtgcctaaacaggttgtt
gttttggattcggagaatttgaagggaaatggtgtagttggggagatagggtttccttta
gtagcgaaaccattagtagctgacgggagcgcaaaatcccacaaaatgtatcagattttt
gacagtgaagggttgaagaggctagatgctcctattatattgcaggactttgtgaaccat
ggtggcgtgattttcaaagtttatgtggctggtgactacgtgcaatgtgtaaagaggaag
tcattgcctgatatatcccaggagaaattagccacattgaagggctccttatcattttct
caaatttcgaatttgactgtgcgagggaagaatgagggctttggtgatgtagttgatctt
gagaaagtggaaatgccgccgttgggatttgtcgaggagatagccagggcaatgaggcgg
gaaacggggcttaatttgttcaactttgatgttattagggatgctaaagataggaatagg
tatcttgtcattgatataaactattttccgggctatgccaagatgccaaattatgagtct
gttttgacagattttttcctggatcttgtccacaataacaatagtagagaaatgcttact
ggaaacattgaggatggagagcaggaaagctatattggtggacttaagggaaacaatgat
tga

DBGET integrated database retrieval system