KEGG   Hevea brasiliensis (rubber tree): 110647339Help
Entry
110647339         CDS       T05150                                 

Definition
(RefSeq) indole-3-glycerol phosphate synthase, chloroplastic-like
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01230  Biosynthesis of amino acids
Module
hbr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    110647339
Enzymes [BR:hbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     110647339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS ThiG
Motif
Other DBs
NCBI-GeneID: 110647339
NCBI-ProteinID: XP_021656807
Position
Unknown
AA seq 388 aa AA seqDB search
MERLVSPRVSPRTTPLFHRPSFSIRRPMNLHMLNRFSVRVQQPDNKVGSATVLAVREEEA
NALQVKEWEVGMLQNELAASQGIRIRRRPPTGPPLHYVGPFEFHVQNEGGNPRNILEEII
WHKDMEVSQLKKRIPFSVLKKSLENAPPSRDFIAALREANLKTGLPGLIAEVKKASPSRG
ILREDFDPVEIAQAYERGGAACLSVLTDEKYFKGSFENLEAIRKAGVKCPLLCKEFVMDS
WQIYYARIKGADAILLIAAVLPDLDIRYMVKICKMLGLAVLVEVHDEREMDRVLGIEGIE
LIGINNRNLETFEVDISNTRKLLEGERGQLIRQKDIIVVGESGLFTPDDIAYVQEAGVKA
VLVGESIVKQSDPGKGITGLFGKEISLS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggaacgattagtttcacctagagtgtcccccaggactactcctcttttccacaggcca
agcttctcaatcagacgcccgatgaacctccatatgctcaatcgtttctctgttcgagtt
caacagccagacaacaaggtaggttcggctacggtgttggccgtgagggaggaggaggca
aatgccctccaagtgaaggagtgggaagtaggtatgctccaaaacgaattggctgctagc
caggggattagaattaggaggaggccgccgacggggccgcctttgcactacgtcggaccc
tttgagtttcatgtacaaaacgagggcggtaaccccaggaacatcctggaggaaatcata
tggcataaggacatggaagtctcccagttgaaaaagaggatacctttctctgtgctgaag
aaatctcttgagaatgctcctccttccagagattttattgcagctctcagggaagctaat
cttaaaactggacttcctgggttgattgctgaggtgaagaaggcttctccaagcagagga
atcctaagagaggacttcgatcctgttgaaattgcccaagcttacgagagaggtggcgct
gcatgtctcagtgttttgactgatgaaaagtattttaaggggagctttgaaaatctggag
gcaataaggaaggcaggagtaaagtgccctctactgtgcaaagaatttgttatggatagt
tggcagatctactatgcccgaattaaaggtgcagatgccattcttttaattgctgctgtt
ttgcctgatctagacatcagatacatggtcaagatctgcaaaatgcttggtttggcagta
cttgttgaggtgcacgatgagagggaaatggatcgtgtgcttggaatagaggggattgag
ctaattggtatcaacaatcgaaatcttgaaacatttgaggttgatatcagtaacacaagg
aagcttcttgaaggagagcgaggtcaacttatccgacaaaaagacataattgtagttggg
gaatctgggctgtttactcctgatgacattgcttatgtacaagaagctggtgtgaaagca
gttttggttggggagtcaattgtgaaacaaagtgaccctggcaagggaataactggactt
tttggtaaagaaatttcattgagttga

DBGET integrated database retrieval system