KEGG   Hevea brasiliensis (rubber tree): 110647769Help
Entry
110647769         CDS       T05150                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hbr01009]
    110647769
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     110647769
Protein phosphatases and associated proteins [BR:hbr01009]
 HAD phosphatases
  Other HAD phosphatases
   110647769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6 Isochorismatase
Motif
Other DBs
NCBI-GeneID: 110647769
NCBI-ProteinID: XP_021657434
Position
Unknown
AA seq 241 aa AA seqDB search
MANSSTTPSVKGPITHVIFDMDGLLLDTEKFYTEVQQIILARYNKTFDWSLKAKMMGRKA
IEAAQVFVQETGISDSLSAEDFLVEREEMLQHMFPTSELLPGASHLVRHLHAKGIPICVA
TGSHRRHFELKTQRHGELFSLMHHVVLGDDPEVKKGKPSPDIFLAAAGRFEGSPVDPKKI
LVFEDAPSGVLAAKNAGMQVVMVPDPRLDISHHETADQILSSLLEFDPAYWGLPAFENVE
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccaattcctccactaccccttcagtaaaaggacccatcactcacgtgatcttcgac
atggatggtctcttactcgacacagagaaattttatactgaagtccagcaaatcatactt
gctagatacaacaaaacctttgattggtctctcaaggcaaaaatgatggggaggaaagca
atagaagcagctcaggtttttgttcaggagactgggataagtgactctctttcagctgag
gactttcttgtagaaagagaggagatgctgcaacacatgtttccaacaagtgagcttttg
ccaggagctagccatttggtcaggcatctccatgcaaaagggataccaatttgcgtggca
actggatctcacaggcggcattttgaattgaaaacacaaagacatggtgagcttttttcc
ttgatgcatcatgttgttcttggagatgacccagaagttaaaaaaggcaagccatcacca
gatatattccttgctgcagctgggagatttgagggcagcccagtagatccaaagaagatt
cttgtttttgaagatgcgccctcaggtgttcttgcagctaagaatgctggaatgcaagtt
gtaatggttccagatccaaggctagatatctctcatcatgaaactgcagatcaaattttg
agctcattactggaatttgatccagcttattggggcttgcctgcctttgaaaatgtggaa
agctaa

DBGET integrated database retrieval system