KEGG   Hevea brasiliensis (rubber tree): 110649027Help
Entry
110649027         CDS       T05150                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2 isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr03040  Spliceosome
hbr04141  Protein processing in endoplasmic reticulum
hbr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110649027
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110649027
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110649027
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hbr01009]
    110649027
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hbr03041]
    110649027
   03009 Ribosome biogenesis [BR:hbr03009]
    110649027
   03110 Chaperones and folding catalysts [BR:hbr03110]
    110649027
   04131 Membrane trafficking [BR:hbr04131]
    110649027
   03051 Proteasome [BR:hbr03051]
    110649027
   03029 Mitochondrial biogenesis [BR:hbr03029]
    110649027
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hbr04147]
    110649027
Protein phosphatases and associated proteins [BR:hbr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110649027
Spliceosome [BR:hbr03041]
 Complex B
  Other components
   Prp19 complex
    110649027
 Complex C
   Prp19-CDC5 complex
    110649027
Ribosome biogenesis [BR:hbr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110649027
Chaperones and folding catalysts [BR:hbr03110]
 Heat shock proteins
  HSP70 / DNAK
   110649027
Membrane trafficking [BR:hbr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110649027
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110649027
Proteasome [BR:hbr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110649027
Mitochondrial biogenesis [BR:hbr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110649027
Exosome [BR:hbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   110649027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 110649027
NCBI-ProteinID: XP_021659116
Position
Unknown
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVVSGPGDKPMIIVNYKGEEKQFAA
EEISSMVLIKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYSYNMRNTVKDEKISSKLAAADKKKIEDAIDQAIQWLDSNQLAEADEFED
KMKELESICNPIIAKMYQGAGADMGGGMDDDTPPAGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaaaggtgaaggaccagcgatcggaatcgatcttggtaccacttattcttgc
gtaggtgtttggcaacacgatagagtggagatcatagctaacgatcaaggcaacagaaca
actccgtcgtatgttgcttttaccgatactgagcgcttgattggtgatgctgccaagaac
caggttgccatgaaccccatcaacaccgtctttgatgcaaagcggttgattggtaggaga
tttactgatgcgtcagttcagagtgacatcaagctctggcctttcaaggtagtttcagga
cctggagataagcccatgattattgtcaactacaagggtgaggagaagcagttcgctgct
gaggaaatatcttccatggttctcattaaaatgcgtgagattgctgaggcctaccttggc
accactgtgaagaatgctgtggtcactgtacctgcctacttcaatgactctcagaggcag
gctaccaaggatgctggtgtcattgcgggtctcaatgtcatgcgaattattaatgagccc
actgctgctgccattgcttatggtcttgataagaaggcaaccagcgtaggtgagaagaat
gtcttgatttttgacttaggtggtggcacttttgatgtgtcactcctcacaattgaggag
ggtatctttgaggtcaaggccactgctggagacacccaccttggaggcgaggactttgac
aacagaatggtgaaccattttgttcaggaatttaagaggaaaaacaagaaagacattagt
ggaaatcctagagctcttaggaggttgaggacagcttgtgagagggcaaagaggaccctt
tcatccactgctcagacaactattgaaattgattctttgtacgagggtattgatttctac
tcaaccatcacccgagccagatttgaagagcttaatatggatcttttcagaaagtgtatg
gagcctgtggagaagtgtttgagggatgctaagatggataagagcaccgtacatgatgtt
gtccttgttggtggctccactaggattccaaaggtgcagcagctattgcaagatttcttc
aatggaaaggagctttgcaagagtatcaacccagatgaagccgttgcttatggtgctgct
gtccaggctgccatcttgagcggtgaaggcaatgagaaggtgcaggatctactgctcttg
gatgtcactcccctgtcccttggtctcgaaactgctggtggggtcatgacagttttgatc
ccaaggaacactaccattccaaccaagaaggagcaagttttctctacctactctgacaat
caacctggtgtgttgatccaggtttatgagggtgagaggacgagaactagggacaataat
ttactgggtaaatttgagctctcaggcattccccctgcaccaaggggtgtgccccagatc
actgtgtgctttgatattgatgccaatggtatcttaaatgtttctgctgaggacaagacc
actggccagaagaataagattacaatcaccaatgacaagggaaggctgtctaaggaagag
attgagaaaatggtacaggaagctgaaaagtacaaatctgaagatgaagagcataagaag
aaggttgaggcaaagaatgctttggagaattattcctacaatatgaggaacacggtgaag
gatgagaagatcagttccaagttggctgctgctgacaagaagaagatcgaggatgccatc
gatcaggccattcagtggctagacagcaaccaacttgcagaggcagatgaatttgaggac
aagatgaaagagctcgagagcatctgcaatccgataattgccaagatgtaccaaggtgct
ggtgctgacatgggtggtggcatggatgatgatactcctccagcgggtggcagcggtgca
ggccccaagattgaggaagttgactaa

DBGET integrated database retrieval system