KEGG   Hevea brasiliensis (rubber tree): 110649065Help
Entry
110649065         CDS       T05150                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK7
Organism
hbr  Hevea brasiliensis (rubber tree)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal APH SKG6 Mid2
Motif
Other DBs
NCBI-GeneID: 110649065
NCBI-ProteinID: XP_021659166
Position
Unknown
AA seq 659 aa AA seqDB search
MASASPPDSPPSPSPPPPTSSNSPPPSSSPPPPSSSSPPPPSSSPPPSSSSPPPPPNNSS
PPPPSDDSPPPSNQSPPPPSDSNSSPPPPTNSNSSPPPPSSSSKKSPPPPPNNNDDDNNF
SPPPPPPPNSSSSKSPPPPPRSLSPTSSSTSGSGINVVPIVIGVVVGVAVVLLLASLAFL
CTGKKKKKKRLEYDYYTEQSPGNNGGNFYNASTPQRPANNWQNGNQFKADKMGNLPPPPG
THGAWQTPSPPPPPPPGPQPPHSPGAVVSGSDMSSNFSGPHGPALPPPHPSVALGFTQSS
FSYEELAAATSGFSLANLLGQGGFGYVHKGVLPNGKEIAVKSLKAGSGQGDREFQAEVEI
ISRVHHRYLVSLVGYCIAGGQRLLVYEFLPNSTLEYHLYGRGLPTMDWSTRIKIAMGSAK
GLAYLHEDCHPRIIHRDIKAANILLDHNFEAKVADFGLAKLSSDNYTHVSTRVMGTFGYL
APEYASSGKLTEKSDVFSFGVMLLELITGRRPVDINSDMDESLVDWARPLCASAVGSRNF
VELADPRLEGNYDPAEMARMVACAGASIRHSARRRPKMSQIVRALEGDVSLEHLNEGVKP
GQSTMFSSSSSEYDNSSYSADMKKFRKVVMENNSQEYPSSEYGHTSEYGLNPSSSSSEN
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgcctcgccgccggattctccaccttctccttctcctcctcctcctacgtca
tcaaattcaccgcctccatcatcttcaccacctccaccttcatcatcatcacctccacca
ccatcatcatcaccccctccatcgtcatcatcaccaccaccaccaccaaataactcctcc
cctccaccaccaagtgatgactccccaccaccttcaaatcagtctccgccacctccaagt
gactcaaattcttcacccccaccaccaactaactcaaattcttcaccgccaccaccttcc
tcttccagcaaaaagtcacctccaccgccaccaaataataatgatgatgataacaatttt
tcaccgccaccacccccacctccaaattcatcatcatccaaatcaccaccaccaccacca
cgatcactatcgcctacatcctcaagcacatctgggagtggaattaacgttgtacccata
gtaattggagtcgtagtaggggtggcagtggtgctgctgcttgcctcccttgcattcctg
tgtacaggcaaaaagaaaaagaagaagaggttagagtatgattactacacagagcaatct
cctggaaacaacggtggtaatttctacaatgcttcaactcctcaacgtcctgctaataac
tggcagaacgggaatcagttcaaagctgacaaaatgggtaatctacctccacctcctggt
acacatggagcctggcaaacgccatcgccaccgccacctccaccgcctggtccgcagcca
ccacattctcctggtgcagttgtatcaggcagtgatatgagttccaatttctcaggccca
catggtccagccttgcctcctccgcacccatccgtggctctcgggttcacccaaagcagc
ttcagctatgaagagctagcggcagctacttctgggttctctctggctaacctattaggc
cagggagggttcgggtatgtgcacaagggggtgctgcctaatggaaaggaaattgcagtg
aaaagtttgaaagctggcagtggacaaggagatcgcgaatttcaagctgaagttgagatt
attagccgcgtccatcatcgctaccttgtctcccttgtcggctattgcattgcaggtggt
cagaggctgctggtttatgaatttttacccaattccaccctagaatatcacctttatggt
cgtggtctcccaaccatggattggtccactaggataaaaattgccatgggatcagccaaa
ggacttgcttacttgcatgaagactgccatcctcgcattatccaccgagatattaaagct
gcaaatattttgcttgatcataattttgaagccaaggtggcagattttgggttggctaag
ctatcttcagacaattacactcatgtgtcaacccgtgtgatgggaacttttggatacttg
gctcctgagtatgcatcaagtggcaaacttactgagaagtctgatgttttctcttttggt
gtcatgttactggaactcataacgggacgccgccctgtggatatcaattcagatatggac
gagagtttagtagactgggctagacctttatgtgccagtgcagtgggtagtcgaaacttc
gtagagttggcggatccacgtctggaaggcaactacgatcctgccgaaatggctcgcatg
gtagcatgtgctggtgcatccattaggcattcagcaaggagaaggccaaaaatgagccaa
attgttcgagcactagaaggtgatgtctcgctggaacacttgaacgaaggggtgaaacct
ggccaaagtactatgttcagttcttctagttccgagtatgacaattcctcgtacagtgca
gacatgaagaagtttaggaaggtggtaatggagaacaacagccaggaatatccaagcagc
gaatatggtcacacaagcgagtatgggctcaacccttcttcctcaagtagtgaaaattag

DBGET integrated database retrieval system