KEGG   Hevea brasiliensis (rubber tree): 110649951Help
Entry
110649951         CDS       T05150                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog NTF4
  KO
K14512  mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr04016  MAPK signaling pathway - plant
hbr04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    110649951
   04075 Plant hormone signal transduction
    110649951
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hbr01001]
    110649951
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110649951
Protein kinases [BR:hbr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110649951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110649951
NCBI-ProteinID: XP_021660405
Position
Unknown
AA seq 406 aa AA seqDB search
MDGGGPAHPADTEMEDAAAAAAPPPPSDPQQQQQPVAPTGGLDNIPATLSHGGRFIQYNI
FGNIFEVTSKYKPPIMPIGKGAYGIVCSALNSETGEHVAIKKIGNAFDNRIDAKRTLREI
KLLRHMDHENVVAIRDIIPPPQRGSFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLY
QILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRA
PELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLLELIGTPSEVELGFL
NENAKRYIRQLPPYHRQSFTEKFPNVHPAAIDLVEKMLTFDPRQRITVEDALAHPYLTSL
HDISDEPVCLTPFSFDFEQNALTEEQMKELIYREGLAFNPEYQHQY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggacgggggcggaccggcccacccggcggacactgaaatggaggatgcggctgccgct
gccgctccaccaccgccgtctgacccccaacaacagcagcagcctgtcgcccctaccgga
ggcctcgataatattccggccactcttagccatggtgggagattcatacagtataatata
ttcggtaacatatttgaggtcacttctaagtataagcctcctatcatgcctatcggcaaa
ggagcatacggcatcgtttgctcggcactgaattccgagaccggcgaacatgtggcgata
aagaagataggaaatgcttttgataatagaatcgacgccaagaggactctccgtgagatc
aagttgcttcgtcatatggatcatgaaaacgttgtggcaatcagggatataatcccccca
ccccaaaggggatcatttaatgatgtttacatcgcttatgagctaatggacactgatctg
catcagataattcgttccaatcaagctctatcagaggagcattgtcagtatttcctgtat
caaattctccgaggattgaaatatatacattctgcaaatgttctgcacagagatttaaaa
ccaagcaatctcctcttgaatgcaaattgtgacttgaagatatgtgattttggtctggct
cgtgttacttcagaaactgatttcatgacagaatatgttgttacaagatggtaccgtgca
ccggaactgttgttgaactcttcagattacactgcggctatagatgtatggtcagtgggt
tgtattttcatggagttgatggatcggaagcccctatttcctggtagagatcatgtgcat
cagcttcgtttgcttttggagctaattggcactccatcagaggttgagttggggtttttg
aatgaaaatgcaaagagatatattcggcaactccctccttatcatcgtcaatctttcact
gagaagtttccaaatgtccacccagcagctattgatcttgttgaaaagatgttaacattt
gatcccagacagaggattacagttgaagatgcactcgctcatccctacctaacatcactt
catgacatcagcgatgagccagtctgcttgacccccttcagctttgattttgagcagaat
gcattgaccgaagagcagatgaaggagctgatttatagggagggtcttgcatttaaccct
gagtatcagcaccaatattaa

DBGET integrated database retrieval system