KEGG   Hevea brasiliensis (rubber tree): 110651147Help
Entry
110651147         CDS       T05150                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110651147
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     110651147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 110651147
NCBI-ProteinID: XP_021662077
Position
Unknown
AA seq 545 aa AA seqDB search
MAFSRIARNGLRRAGGTFGSYAEKGTACEGVSNHKWSSPFLKNVAAGNNLSYISSIRKAN
HASFWSRGIGGTPHYQFPNAERILEESENEYEEPRYPGLEATRPAEKPRVVVLGTGWAAC
RFMKGLDTKIYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSRIQSALATSPNSYF
YLASCTGIDTDKHEVYCETVSNGGLPQEPHQFKVAYDKLVIAAGAEPLTFGIKGVNEHAY
FLREVNHAQEIRKKLLMNLMLSENPGIPEEEKNRLLHCVVIGGGPTGVEFSGELSDFIMR
DVQERYSHVKDHIKVTLIEANEILSSFDVGLRQYATNHLTKCGVRLTRGVVKEVHPTKLF
LSDGTEVPYGLLVWSTGVGPSQFVKSLNLPNSPGGRIGIDQWLRVPSVEDVFALGDCAGF
LEQTGRPVLPALAQVAERQGKYLVELFNNIGKQNGGKAFSAKDFSLGDPFVYRHLGSMAS
VGRYKALVDLRQSKDAKGLSLAGFISWLIWRSAYLTRVVSWRNRFYVAVNWATTLVFGRD
NSRIG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcaaggattgctaggaatggcttgagaagagcaggaggcacctttggtagt
tacgcagagaaaggtacagcatgtgagggagtatccaatcataaatggtcttcacctttc
cttaaaaatgttgcagcaggcaacaacctatcgtacatttccagcatcaggaaggcaaat
catgccagtttttggagcaggggaattgggggaaccccacattatcaatttcctaatgca
gagaggattctggaagaatcagaaaatgagtatgaagaaccaaggtatccaggtctagaa
gcaacaaggcctgctgaaaagccaagggtggttgtccttggcactggatgggctgcatgt
cgattcatgaaaggacttgacaccaaaatctatgatgttgtttgcatatcaccaaggaat
cacatggtcttcactcctttgcttgcatcaacttgtgttggaaccctggagtttcgttct
gtagctgagcctgttagtcggattcagtctgcattggcaacaagtcccaactcatatttt
tatttggcttcctgcactggcattgacacggacaaacacgaagtgtactgtgagacagta
agcaatggtggattacctcaggagcctcaccagtttaaagttgcatatgataagcttgtc
attgctgctggagctgagcctctgacttttggtatcaagggagtgaatgaacatgcttat
tttcttagagaagtgaatcatgctcaagaaataaggaagaagctccttatgaatctcatg
ctatctgaaaatccaggcatacctgaagaagagaagaaccgcttattacactgtgtcgtt
attggaggtggtccaacaggggtggagtttagcggtgaattgagtgattttatcatgaga
gatgttcaggagcggtattctcatgttaaggatcatataaaggtcacccttattgaggcc
aatgaaattctatcatcctttgatgttggactacggcaatatgcaacaaatcatttgact
aagtgtggtgtccgtcttacaagaggtgtagtgaaagaggtgcatcccacaaaattattt
ctcagtgacggtacagaagtcccatatggcctcttggtatggtctactggtgtcggtcca
tctcagtttgtcaagtcactaaatcttcccaactcccctggtggaaggattggtattgat
caatggttgcgggtcccttctgtggaagatgtatttgcacttggagactgtgctggtttt
cttgagcagacaggaaggccagtgcttccagctctagctcaggttgcagaaaggcaaggg
aaatatctagttgagttgtttaacaatattggaaagcaaaatggaggcaaggctttcagt
gcaaaagatttctctctaggagatccttttgtctacaggcatctgggtagcatggcatcg
gtagggcgttacaaggcactggttgatctgcgccagtctaaggatgcaaaaggcttatca
cttgctggattcatcagttggctaatctggcgctctgcatatcttacacgagtggtcagt
tggaggaacagattttacgtggcagtgaattgggcaaccaccctggtttttggcagagac
aactcaaggattggatag

DBGET integrated database retrieval system