KEGG   Hevea brasiliensis (rubber tree): 110651206Help
Entry
110651206         CDS       T05150                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00010  Glycolysis / Gluconeogenesis
hbr00071  Fatty acid degradation
hbr00350  Tyrosine metabolism
hbr00592  alpha-Linolenic acid metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110651206
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110651206
   00592 alpha-Linolenic acid metabolism
    110651206
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110651206
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     110651206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C 2-Hacid_dh_C AlaDh_PNT_C IlvN UDPG_MGDP_dh_N CTNNBL Pep_deformylase
Motif
Other DBs
NCBI-GeneID: 110651206
NCBI-ProteinID: XP_021662157
Position
Unknown
AA seq 380 aa AA seqDB search
MAGTAGKVIRCKAAVAWEAGKPLVIEEVDVAPPQANEVRLKILFTSLCHTDVYFWEAKGQ
NPLFPRIYGHEAGGIVESVGEGVTDLKPGDHVLPVFTGECKECSHCKSEESNMCSLLRIN
TDRGVMLHDGKSRFSIKGKPIYHFVGTSTFSEYTVIHVGCLAKINPLAPLDKVCVLSCGI
STGLGATLNVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGVDLNSNRFEDAKKFG
VTEFVNPKHHRKPVQEVIAEMTDGGVDRSVECTGNIDAMISAFECVHDGWGIAVLVGVPH
KEAVFKTHPMNVLNERTLKGTFFGNYKPRTDLPSVVEKYMNKELELEKFITHSVPFSQIN
KAFELMLKGESLRCIIRMEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcactgctggaaaggtcattcgttgcaaagctgctgtggcatgggaggctggg
aagccactggtgatcgaagaagtggatgtggctcctcctcaggccaatgaagttcgtttg
aagatcctcttcacttctttatgtcacactgatgtttacttctgggaagccaagggtcag
aatccattatttcctagaatttatggtcatgaggcaggagggattgtggagagtgttggt
gaaggggtgactgatctcaaaccaggcgatcatgtcctccctgtgttcactggggaatgt
aaggaatgttctcactgcaaatctgaagagagcaacatgtgtagcctcctcaggataaac
acagataggggagtgatgcttcatgatggaaaatcaagattctcaatcaaaggaaagcct
atttaccactttgttgggacatctacctttagtgagtacactgtgattcatgttggctgt
cttgccaagatcaatcccttggctcctctagacaaagtctgtgtcctaagttgtggaatc
tccacaggtcttggtgccactctgaatgttgctaagcctccaaagggttcaacagtggct
atctttggattgggagctgtaggccttgctgctgctgaaggggctaggattgctggggct
tcaagaatcattggtgttgatctgaattcaaataggtttgaagatgcaaagaagtttgga
gtcactgaatttgtgaacccaaaacatcacaggaaaccagttcaggaggtgattgctgag
atgactgatggaggagtggacagaagcgtagagtgtacaggaaacattgatgctatgatt
tctgcatttgaatgtgtacatgatggttggggaattgctgtactggttggagtgccacac
aaagaagcagttttcaagacccacccaatgaatgttttgaatgaaaggactctcaaaggt
accttctttggaaactacaagcctcgcactgaccttccttcggttgtggaaaaatacatg
aacaaggagcttgaacttgaaaagtttatcacccattcagtccctttctctcagatcaat
aaggcatttgagttgatgcttaaaggggaaagccttcgctgcatcatccgtatggaggga
tag

DBGET integrated database retrieval system