KEGG   Hevea brasiliensis (rubber tree): 110652017Help
Entry
110652017         CDS       T05150                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00350  Tyrosine metabolism
hbr00360  Phenylalanine metabolism
hbr00380  Tryptophan metabolism
hbr00950  Isoquinoline alkaloid biosynthesis
hbr00965  Betalain biosynthesis
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110652017
   00360 Phenylalanine metabolism
    110652017
   00380 Tryptophan metabolism
    110652017
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    110652017
   00950 Isoquinoline alkaloid biosynthesis
    110652017
   00965 Betalain biosynthesis
    110652017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hbr04147]
    110652017
Enzymes [BR:hbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110652017
    4.1.1.105  L-tryptophan decarboxylase
     110652017
Exosome [BR:hbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110652017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110652017
NCBI-ProteinID: XP_021663205
Position
Unknown
AA seq 491 aa AA seqDB search
MGSLPTDTFSPLDSNTFIDESKMVIDFISDYYKNIEKYPVRSQVQPGYLSGELPQSAPYS
PESLEDILKDVSDKIMPGLTHWQSPNFFAYFQANASNAGFLGEMLCSGLNIVGFNWISSP
AATELESLVIDWLGKLLKLPPSFLFSGNGGGVLHGSTCEAVVCTLAAARDKSLKRMGWDK
ITKLVVYASDQTHATLFKGTKLVGIPSSNIRSLPTSFLSGFSLPPQTLQEAIENDIKSGF
YPLFLCATVGTTACGAVDPIRELGEIATKYNLWFHIDAAYAGSACICPEFRHYLDGVELA
DSISMNPHKWLLTNMDSCCLWVKQPHSLINSLASDAEFLRNSASESNNVVDYKDWQIALS
RRFKALKLWVVLRRHGLSNIMYHIRSDVNLAKRFESLVSTDKRFEIVVPRRFALVCFRLK
PNNGVNGSELNRRLLSSVNESGRAFMTHGVAGGEYFIRCAIGSTLTEERHVSELWKLIQD
KAQTILANAAT
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtctccccacagacaccttctcccctttagactctaatactttcatagatgag
tcaaaaatggtgatcgatttcatttctgactattacaagaatatagaaaaatacccagtt
cgaagccaagttcagcctggatacctttcaggcgaattgcctcagtcagcaccatatagt
cctgagtcattggaagatatcctaaaagacgtttcggataaaattatgccaggcctcact
cactggcaaagtcccaacttctttgcatacttccaagcaaatgccagcaatgctggcttt
cttggagagatgctttgttcaggcctgaatatcgttggcttcaattggatttcatctcca
gccgcaaccgaactagaatcccttgtcatagattggctgggaaaattgttgaagcttccg
ccctcatttctcttctctggtaatggaggcggtgtcttgcacggcagcacatgtgaggct
gtagtatgcactttggctgcagcaagagataagagcttgaaaaggatgggatgggataaa
attacaaagttggtggtttatgcctctgatcaaactcatgccactctcttcaagggtacc
aaattagttggtatcccatcctctaatatccgttctctccctacttcatttttatctggg
ttttccttgccacctcaaacacttcaagaagcaatcgaaaatgatataaaatctgggttt
tatccattgtttctttgtgccactgtgggaacaactgcctgcggagcagttgatcctata
cgagaactgggggaaattgctacgaaatacaacttatggttccacattgacgcagcttat
gctgggagtgcctgcatatgccccgagttcaggcattatttggatggtgtagaacttgca
gattcaattagtatgaacccacataaatggttactcactaacatggacagttgttgtttg
tgggttaagcaaccccattcattaatcaactcattagccagtgatgcagaattcttgagg
aattccgcgagtgaatcaaacaacgtagtggactacaaagattggcaaattgcattgagc
aggcgattcaaggccttaaagctttgggttgttctacgtagacatggattgagcaatatt
atgtaccacatacgcagcgatgtgaatttggcaaagaggtttgagtccctggtgagtacg
gacaagaggttcgagatagtagtgccaaggaggttcgccttggtttgcttcaggctcaaa
cccaataatggagtcaatggctccgaattgaacaggcgactactgtcttctgtgaacgag
agcggacgtgccttcatgactcatggggtggcaggaggagagtattttatccgctgtgcg
attggatccacattgactgaagaaagacatgtaagtgagttgtggaagctgattcaagat
aaggctcaaacaattcttgctaatgcagcaacgtaa

DBGET integrated database retrieval system