KEGG   Hevea brasiliensis (rubber tree): 110652233Help
Entry
110652233         CDS       T05150                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110652233
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     110652233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 NAD_binding_8 DAO EF-hand_7 EF-hand_8 p25-alpha LysR_substrate NAD_binding_7 EF-hand_10 DUF1858 BET
Motif
Other DBs
NCBI-GeneID: 110652233
NCBI-ProteinID: XP_021663481
Position
Unknown
AA seq 586 aa AA seqDB search
MKGLSLFERASRSFHGYPFLSKFIVVCAVSGGGLVAYADANSSNGVHALATPEPVSKKKK
VVVLGTGWAGTSFLKKLNSPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIV
RKKNVDICFWEAECFKIDAENKKVYCRSNQNANMNGKEEFVVEYDYLVIAMGARPNTFNT
PGVMEYCNFLKEVEDAQKIRRSVIDNFEKASLPNLSDEERKRILHFVVVGGGPTGVEFAA
ELHDFVNEDLIKIYPSAKDFVKITLLEAADHILNMFDKRITDFAEEKFRRDGIDVKLGSM
VVKVSDKDISTKVRGSGETTSIPYGMVVWSTGIGTHPVIRDFMRQIGQTNRRALATDEWL
RVQGFNNVYALGDCATINQRKVMEDISAIFKKADKDNSGTLTVKEFQEVINDICERYPQV
ELYLKNKKMRNIVDLLKEAKGDVAKESIELNIEEFKTALSEVDSQMKNLPATAQVASQQG
TYLANCFNRMEEVENNPEGPLRFRGEGRHRFRPFRYKHLGQFAPLGGEQTAAQLPGDWVS
IGHSTQWLWYSVYASKQVSWRTRALVVSDWTRRFIFGRDSSRTANN
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtttaagcttgttcgagcgagcttctagatccttccatggctatcctttcctc
tctaagtttattgtggtttgcgccgtcagtggtgggggacttgtagcctatgctgatgca
aactcatccaatggagtacatgctttggcaacacctgagccggtgagcaagaaaaaaaag
gtcgttgtgcttggaactggttgggcaggaacaagttttttgaagaaactaaatagccca
tcatatgatgttcaagtgatatcacctcgtaactacttcgcgttcactcccttgctacca
agtgttacatgtggtacggtggaagctcgcagcatcgttgaacctattcgcaacattgtc
aggaagaaaaatgtcgacatttgtttctgggaagctgaatgtttcaagattgatgcagaa
aacaaaaaagtttactgtcgatctaaccaaaatgcaaacatgaatgggaaagaagaattc
gttgtagaatatgactacctcgtaatagccatgggagctcgaccaaatacattcaacaca
cctggagtgatggagtattgcaatttcttgaaggaggttgaagatgctcagaagatccgt
aggtctgttattgacaactttgagaaggccagtctgccaaatttaagcgatgaagagaga
aaaagaattcttcattttgtagtggttggtggtggtccaactggtgtggaatttgctgca
gagcttcatgattttgtgaatgaggatctaatcaaaatatatccttcagctaaagatttc
gtaaaaataacacttcttgaggcagcagatcatattctgaacatgtttgacaaaagaatc
acagattttgctgaagaaaagttcagaagagatggcattgatgtgaaattagggtcaatg
gttgtgaaagtatctgataaagacatttctactaaagtaagggggagtggagaaactact
tctattccttatggaatggttgtctggtcaactggaattggaactcatcctgtcattagg
gacttcatgaggcaaattggtcagactaacaggcgtgctctagcaactgatgagtggctg
agagttcagggatttaacaatgtatacgcccttggtgattgtgcaacaattaaccagcgt
aaagtcatggaagatatctcagcaatatttaagaaggcagacaaggacaattctggaaca
ctcacagtaaaagaatttcaagaagtcattaatgacatttgtgaaagatatccccaagtg
gaactttatttaaagaacaagaaaatgcgcaatattgttgatctgctgaaggaagccaaa
ggggatgttgcaaaagaatctattgaattaaatatcgaggagtttaaaacagctctttct
gaagtggattctcagatgaagaatcttccagcaacagcgcaggttgcgtctcaacaaggt
acctaccttgccaattgcttcaaccgcatggaagaagttgagaataatccagaaggccct
ctcaggttcaggggagaaggtcgccatagatttcgccccttcaggtacaagcatcttggt
caatttgctccactagggggagagcaaacggcagcacaacttcccggtgattgggtttca
attggacacagcactcagtggctttggtattctgtctatgctagtaagcaagtaagctgg
cgtacaagggcattggttgtgtctgactggacgaggcgtttcatctttggaagggattcc
agtaggacagcaaataattaa

DBGET integrated database retrieval system