KEGG   Hevea brasiliensis (rubber tree): 110653278Help
Entry
110653278         CDS       T05150                                 

Definition
(RefSeq) polygalacturonase-like
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00040  Pentose and glucuronate interconversions
hbr01100  Metabolic pathways
Module
hbr_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110653278
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     110653278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 110653278
NCBI-ProteinID: XP_021664525
Position
Unknown
AA seq 176 aa AA seqDB search
MALPGLHLYSFFIIISFAIIPYYHCLQGDTLNAYLQEEGNQELGYDFRAYPSYFNSIIED
GQFKDFIKLRSTNILNLKVFDDQVGSISTSVKKFIVDDFKAEANGTDDTEAFQKAWEEAC
SSEAGVLVVPESRYRLKPLRFSGPCKSNLTVVQIFGTIEASDDRSDYDEDERHWLV
NT seq 527 nt NT seq  +upstreamnt  +downstreamnt
atggctttaccaggacttcacctttattcattcttcatcatcatttcttttgctattatt
ccttattatcattgcttgcaaggagacacccttaatgcttaccttcaagaagaaggtaat
caagaattggggtatgattttcgagcttatccttcttattttaactccattattgaggat
ggccagttcaaggacttcatcaagttaagatctactaatattcttaatttgaaggtattt
gatgatcaagtaggtagcatatcaacttcagtcaaaaaatttatagttgatgatttcaaa
gctgaagccaatggcactgatgacactgaagcatttcaaaaggcatgggaggaagcttgt
tcatctgaagcaggtgtccttgttgtgcctgaaagcaggtatcgattgaagccattgaga
ttctcaggaccttgcaaatccaatcttacagtagtgcagatatttggaaccattgaagca
tcagatgatcgatcagactatgatgaagatgaaagacactggcttgt

DBGET integrated database retrieval system