KEGG   Hevea brasiliensis (rubber tree): 110653674Help
Entry
110653674         CDS       T05150                                 

Definition
(RefSeq) receptor-like cytosolic serine/threonine-protein kinase RBK1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hbr01001]
    110653674
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110653674
Protein kinases [BR:hbr01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110653674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Retrotran_gag_2 DUF4219 DUF643
Motif
Other DBs
NCBI-GeneID: 110653674
NCBI-ProteinID: XP_021665121
Position
Unknown
AA seq 432 aa AA seqDB search
MKAYLRAFDLWEAVETGRDPPPLRVDPMLAQIKYYSEECAKKYKALFYLHQAVSDVIFTR
IMSCEIAKEAWDKLKEEFHGSDKTRQMQILNLRRDIEVLRMKDSKSIKEYSDGLIKTINQ
IRLLRDELTNKRIVEKAVEPKSVRMEEKYEEALMAKQKGMVQATSEGKRSGRERKFKSKK
DEGYKRKTEMTLNVSGRGDCLEWKKRFKVAAGIAEGLQYLHHDCRRRIIQRDIKASNILL
GEDYEAQISDFGLAKWLPENWVHLVVFPTEGTFGLGLMELIMDFGYLAPEYFMHGIVDEK
TDVFACGVLLLEIITGRHAVDSSRQSLAMWAKPLLQENNAKEVADPWLREDYDPIEMKRA
MLTASECINHLPSMRPHMNRAVQLLRGEETPIELKQKTNAGRAVILDGCDMQDYTCTSYL
NDLNRHMQLVME
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctatctaagggcttttgacctttgggaggcagtggaaacagggagagatcca
ccacccttgagagttgatcctatgttagctcaaataaagtattactctgaggaatgtgca
aagaagtataaagctttgttctatttgcaccaagctgtatctgatgttatattcacaagg
attatgtcttgtgaaatagctaaagaggcatgggataagctcaaggaggagttccatggt
agtgacaaaacaagacagatgcagatattgaatctcagaagagacattgaggttttgaga
atgaaagattctaaatcaataaaagaatactcagatgggcttataaagaccataaatcag
ataaggctgcttagggatgagttaacaaataagagaatagtagagaaagcagtagaacca
aagagtgtgaggatggaagaaaaatatgaggaagcattaatggcaaaacaaaaaggaatg
gttcaagctacttcagaagggaaaagatctggtagagaaagaaaatttaaaagcaagaaa
gacgaaggctacaagagaaaaacagagatgacattaaatgtttcaggcagaggagattgt
ctagaatggaagaaaaggtttaaggtagctgcaggaatagcagaaggattgcagtatctc
catcatgattgccgaagacgcattatccagagagacatcaaggcctctaacatattgctt
ggtgaagattatgaagctcagatttctgattttggattggcaaagtggctcccagaaaat
tgggttcatcttgttgtctttcccactgagggcacattcgggttaggacttatggaactt
attatggatttcggatatttggctccagaatattttatgcatgggatagtcgatgagaag
actgatgtatttgcttgtggtgttttattactagagataataacaggtcgtcatgcagtt
gattcgagtagacaaagccttgcaatgtgggcaaaaccacttttacaggaaaacaatgct
aaagaagtagctgatccatggctcagggaagattatgatcctattgaaatgaagcgtgcc
atgttaacggcttcagagtgcattaaccacctaccatcaatgcgtccacacatgaaccgg
gctgtgcagctgctgaggggtgaggaaacacctatagagttgaagcaaaagactaatgct
ggaagggctgtgattttagatggttgtgacatgcaagattatacttgcaccagctacctc
aatgacctcaatcgccatatgcaacttgtgatggagtag

DBGET integrated database retrieval system