KEGG   Hevea brasiliensis (rubber tree): 110654834Help
Entry
110654834         CDS       T05150                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00051  Fructose and mannose metabolism
hbr00520  Amino sugar and nucleotide sugar metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
Module
hbr_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    110654834
   00520 Amino sugar and nucleotide sugar metabolism
    110654834
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     110654834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 110654834
NCBI-ProteinID: XP_021666651
Position
Unknown
AA seq 456 aa AA seqDB search
MMDEKRRRLIRRSQLYNCVCLLLVLGSHKQLGLWVSVRVLAMADSEKVVAVIMVGGPTKG
TRFRPLSFNTPKPLFPLAGQPMVHHHISACKRIPNLARIFLIGFYEEREFTLYVSSISNE
LKVPVRYLKEDKPHGSAGGLYYFRDIIIEDSPSHIFLLNCDVCCSFPLPDMLEAHQKYSG
MGTMLVIKVSAESANQFGELVADPATKELLHYIEKPETFVSDLINCGVYVFTPEIFTAIQ
GVFTNREDRANLLRVSSFESLQSVTRTSLPTDFVRLDQDILSPLAGKKLLYTYETTDFWE
QIKTPGMSLKCSALYLSQYQFTSPHLLATGDGSRNASIIGDVYIHPSAKVHPTAKIGPNV
SVSANVRVGAGVRLISCIILDDVEIQENAVVMHSIIGWKSSLGRWSRVQADGDYNTKLGI
TILGEAVTVEDEVVVTNCIVLPNKIINGSVQEEIIL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgaaaaacgacgtcgtttgatcaggcgtagtcaactatataactgtgtatgc
cttcttctcgttttgggtagtcataagcagttaggtctttgggtttcagtcagggttttg
gcaatggcggattctgagaaggtggttgccgtgatcatggtcggtggacctaccaaaggt
actagatttaggcctctctcattcaatactccaaaacccttgttccctttggctgggcag
cctatggttcaccatcacatttctgcttgtaaaaggatacctaatttggctcggattttc
ctaattggattctatgaggagcgggaatttactttatatgtgtcttcaatctctaatgaa
ctcaaagtacctgtaagatacttgaaggaagacaaaccgcatggttctgctggtggtctt
tattattttagagacataatcattgaagatagtccgtcgcatatctttctgttgaactgt
gatgtttgctgtagttttcctttgccagatatgcttgaggcacatcaaaaatacagtggt
atgggaacaatgttagtaatcaaggtttctgctgaatcagccaaccaatttggtgaattg
gttgctgatcctgccactaaagagctgttgcattatatagagaaaccagagacttttgta
agtgatttgataaactgtggtgtctatgtcttcaccccagagatctttactgccattcaa
ggtgtcttcactaatcgagaagacagagcaaatctattacgtgtatccagctttgagagc
cttcagtctgtaacaagaaccagtcttcctacagatttcgtaaggttagatcaagatatt
ttgtcgcctcttgctggaaagaagctattgtatacatatgagaccactgatttctgggaa
caaatcaagactccaggaatgtctttgaaatgttctgctttatatctttcccaatatcaa
tttacctctcctcatctgttggccactggggatggatctaggaatgcgagcattatcggt
gatgtttatattcatccatcagcaaaagtgcacccaactgcaaagattggccccaatgtc
tctgtttcagcaaatgttcgtgtaggagcaggagtgaggcttataagttgcattatttta
gatgatgttgaaattcaggaaaatgcagttgttatgcattctattattggttggaaatca
tctctaggaagatggtcaagagtccaggctgatggagactacaatacaaagcttggaata
accattcttggagaagctgtgacagttgaagatgaagttgttgttactaactgtattgtt
cttccaaataagatcattaacggtagtgtgcaggaggaaatcatcttataa

DBGET integrated database retrieval system