KEGG   Hevea brasiliensis (rubber tree): 110656216Help
Entry
110656216         CDS       T05150                                 

Definition
(RefSeq) arginase 1, mitochondrial-like isoform X1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00220  Arginine biosynthesis
hbr00330  Arginine and proline metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01230  Biosynthesis of amino acids
Module
hbr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110656216
   00330 Arginine and proline metabolism
    110656216
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     110656216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 110656216
NCBI-ProteinID: XP_021668526
Position
Unknown
AA seq 356 aa AA seqDB search
MSVVGHRGIQYLQKLKAANIPAELIEKGQNRVIDASLTLIRERAKLKGELVRALGGVVAS
SSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELNDPRVLTDVGDVPVQE
IRDCGVDDDRLMNVISESVKPVMEEDPLRPLVLGGDHSISFPVVRAVSEKLGGPVDILHL
DAHPDIYHAFEGNIYSHASPFARIMEGGYARRLLQFQQLHPKYVLCWNNAVNRVGIRSIT
KEGREQGKRFGVEQFEMRTFSRDRQLLENLKLGEGVKGVYISIDVDCLDPGFAPGVSHIE
PGGLSFRDVLNILHNLQADVVAADVVEFNPQRDTLDGMTAMVAAKLVRELTAKISK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttgtagggcatagaggaattcagtacttgcagaaactaaaagctgcgaacatc
cctgctgagttgatagagaagggccaaaatcgcgttattgatgcttctcttactcttatt
cgcgagagagcaaagcttaagggagagcttgtgcgcgctctaggaggtgttgtagcatct
tcatctcttcttggtgttcctctgggacataactcatcatttcttcagggcccagcgttt
gctcctcctcgaattagagaggccatctggtgtggtagcactaactcggcaactgaagaa
gggaaggaattaaatgaccctcgggttctaactgatgttggtgatgtccctgtccaagaa
attcgagattgtggtgtagatgatgacagattgatgaatgttataagtgagtccgtcaag
ccagtgatggaagaggatccattacgtccattagttttaggtggtgaccattcaatatct
tttcctgtggtacgggctgtctctgagaagcttggcggacctgtggatattcttcatctg
gatgctcatccggatatatatcatgcttttgaaggaaatatatattctcatgcatcgcca
tttgcccgaataatggaaggtggttatgcgcggcggctattgcaatttcagcagcttcac
cccaaatatgtcctctgttggaacaatgctgtcaatagagtgggtatcagatcaatcaca
aaagaaggccgtgagcagggcaaaaggtttggagtggagcaatttgaaatgagaaccttc
tcaagagatcgccagcttttggaaaatttgaaattaggggaaggtgtaaagggtgtttat
atatcgatagatgtggactgccttgaccctggttttgctcctggtgtatctcacattgag
cctggcggtctctctttccgtgatgttctcaacattctccacaaccttcaagctgacgtt
gttgcagcagatgtggttgaattcaatccacagcgcgacactcttgatgggatgactgca
atggttgctgccaagctggtaagagaactgactgcaaagatatcgaaatga

DBGET integrated database retrieval system