KEGG   Hevea brasiliensis (rubber tree): 110656235Help
Entry
110656235         CDS       T05150                                 

Definition
(RefSeq) glutathione S-transferase 2-like isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00350  Tyrosine metabolism
hbr01100  Metabolic pathways
Module
hbr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110656235
Enzymes [BR:hbr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     110656235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 110656235
NCBI-ProteinID: XP_021668560
Position
Unknown
AA seq 226 aa AA seqDB search
MEHKSQQRDLATSSPNLVLYSYWQSSCAWRVRFALNLKGLSYEYKAVNLAKGEQFSPEFE
RLNPLHFVPVLVDGDVVVSDSYAILLYLEEKYPQKALLPDDPQRRALNLQAASIISSSIQ
PLHMLSMLKYFEEKMGPDEALLWGQSCVEKGFLALERLLKDFAGRYATGEAVFMADVFLA
PQIAVALMRFKIDMSKFPTLGRIYESCKGLPEFVGSLPQSQPDAEQ
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaaagccagcagagagaccttgcaacttcatcgccaaatcttgtcctgtac
tcctattggcagagttcctgcgcatggcgtgtccgctttgctctaaacctgaaagggctt
tcttatgagtacaaagcagtgaaccttgcaaaaggagagcagttttctccagagtttgaa
cgattaaatcctcttcattttgttccggtgttggttgatggtgatgtggtggtctcagac
tcttatgcgatattgctgtatttggaagaaaagtatcctcaaaaagcattgttgccagat
gatcctcagcgaagagctttgaatctgcaggctgccagcatcatcagctctagcatacaa
cctcttcatatgttgtcaatgctgaaatactttgaagaaaaaatgggtcctgacgaggca
ttattatggggtcaatcttgtgtagaaaaaggtttccttgctcttgagaggttgctgaaa
gattttgcaggcagatatgccacaggagaagcagtatttatggctgatgtgtttctggcc
ccacaaatagctgtggctttaatgaggttcaaaattgatatgtccaagttcccaacttta
ggtaggatatatgaatcatgcaagggcttacctgagttcgtaggttcactcccacaatca
caacctgatgcagagcagtaa

DBGET integrated database retrieval system