KEGG   Hevea brasiliensis (rubber tree): 110657513Help
Entry
110657513         CDS       T05150                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial isoform X1
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00970  Aminoacyl-tRNA biosynthesis
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110657513
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hbr03029]
    110657513
Enzymes [BR:hbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     110657513
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     110657513
Mitochondrial biogenesis [BR:hbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    110657513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 110657513
NCBI-ProteinID: XP_021670442
Position
Unknown
AA seq 550 aa AA seqDB search
MAFTLFRNIQTYPLLLYPTAFFRRNNFVFYCMMKSTTQSQTATRENQHSPQIKVSPQTQS
KTLDKLTKDYEAIIGIETHVQLSTLTKAFCGCPYNYGAQPNSSICPICMGLPGALPVLNS
RVIEFAVKLGLALNCKLSLNSKFDRKQYFYPDLPKGYQISQFDVPIAIGGHIDLDLPVEF
GGGHRRFGITRVHMEEDAGKLLHSGNGSYSQVDLNRAGVPLLEIVSEPDMRNGIEAAEYA
AELQRVVRYLGVSNGNMQEGSLRCDVNVSIRPIGQSEFGTKVEVKNLNSFSSINRAIDFE
ISRQVLLHSQGQGDSIVQETRLWEEGSQKTVSMRKKEGLSDYRYFPEPDLPEVIITKEYV
DSIRNSLPELPEMKRRRYESMGLSMQDVLFLANDISVAEFFDATIAKGADVKLATNWIMG
DIAAYMKNEKVSINEIKLTPQELAELIASIKGGTISGKIGKEILFELIAKGGTVKGLIEE
KDLVQIVDPAEIEKMVVKVISENPKQLEQYRAGKTKLQGYFAGQVMKVSKGKANPGLLNK
ILLEKLNDKS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcacattgtttagaaacattcaaacctaccctttattgctatatccaactgca
ttctttagaagaaataattttgttttctactgcatgatgaaaagcacaacgcaaagtcaa
acagctactcgagaaaaccagcacagtccgcaaattaaagtttcaccacaaacccagtcc
aaaacccttgataaactcacaaaagattatgaggcaatcattggtatagaaacccatgtc
caactctctactttaaccaaggccttctgtggctgcccatataactatggggctcaacca
aactccagtatctgccccatttgtatgggtttacctggtgctttaccagttttgaactct
agagttattgaatttgctgtgaaattaggccttgcacttaattgcaagctgtctttgaac
tcaaagtttgatagaaaacagtacttttaccctgaccttccaaagggataccaaatatct
cagtttgatgtaccaatcgcaatcggtggtcacattgatttagatctccctgtggaattt
ggtggtgggcatagaaggtttggcattaccagggttcacatggaagaggatgcagggaag
ctgcttcattcaggaaatggaagttactcacaggttgatctgaacagggctggggtacca
ttgcttgagattgtttctgaacctgatatgagaaatggtattgaagctgcagaatatgca
gcagaactacagcgggtggttaggtatttgggagtgagcaatggcaatatgcaggaaggt
tctcttcgctgtgatgtgaatgtttcaattcgaccgattgggcaatcagagtttggaacg
aaggttgaggtaaagaatttaaactcattttcatcaattaatagggccattgattttgag
atatcaaggcaagtgctcctccacagtcaaggccaaggtgattcaattgtacaagaaact
agactttgggaagaaggttctcagaaaacagtttcaatgaggaaaaaggaggggctttct
gattatcgatattttcctgaaccagaccttccagaagttattatcacaaaagaatatgtt
gatagtatccgaaattctttgccagaacttccagaaatgaagcgtcggagatatgagagc
atgggcctaagcatgcaggatgttcttttccttgcaaatgacataagtgttgcagaattt
tttgatgcaaccattgcaaagggtgctgatgtgaagctggctaccaactggataatgggt
gatattgctgcctacatgaaaaatgaaaaagtgtctataaatgagatcaaacttacccct
caagagctagctgagctgattgcatcaattaaaggtggcactattagtggaaagattggg
aaagagatattgtttgagctcatagccaaaggcggaactgttaagggactgatagaagaa
aaggatcttgttcagattgtagatcctgctgaaattgagaaaatggtggttaaagtaata
tctgagaatccaaagcagttggaacaatatcgtgcaggcaaaaccaagctacaaggttat
tttgcaggccaggtgatgaaagtatcaaaaggtaaggcaaatccagggcttctgaacaag
atccttctagaaaaattaaatgacaaaagttga

DBGET integrated database retrieval system