KEGG   Hevea brasiliensis (rubber tree): 110658256Help
Entry
110658256         CDS       T05150                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00630  Glyoxylate and dicarboxylate metabolism
hbr00710  Carbon fixation in photosynthetic organisms
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01200  Carbon metabolism
Module
hbr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
hbr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
hbr_M00532  Photorespiration
hbr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110658256
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110658256
Enzymes [BR:hbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110658256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 110658256
NCBI-ProteinID: XP_021671483
Position
Unknown
AA seq 174 aa AA seqDB search
MSTAGIFTAPAVTGSGCQGLKANSTRQLFPAKDSIAWSRKTVSNGSRTHCMKTWNPINNK
KFETLSYLPPLSDDSIAKEIDYMIKKGWIPCLEFDEVGHVQRENSRMPGYYDGRYWTLWK
LPMFGCNDSSQVLNEIHECKKAYPNAYIRCLAFDNKHQGQCMAFIIQKPNTTTP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgccggaatctttacagctccggccgttactggatctggttgccaaggcctc
aaagccaactcaacaagacagttgttccctgcaaaggattctattgcatggagtcgcaaa
actgtctccaatggctccagaactcattgtatgaagacatggaacccaatcaataacaag
aagtttgaaactctatcctacctccctccactttctgatgactcaattgcgaaggagatt
gactacatgattaaaaagggatggatcccttgtcttgaattcgatgaggtggggcatgtg
caaagagagaatagccgaatgccaggatactacgatgggaggtactggacactatggaag
ctccccatgtttgggtgcaatgactcatctcaagtgctcaatgaaatccatgaatgcaaa
aaagcatacccaaatgcatatatccgctgcttagcatttgacaacaagcaccagggtcag
tgcatggcctttatcattcaaaagcctaacaccaccaccccctaa

DBGET integrated database retrieval system