KEGG   Hevea brasiliensis (rubber tree): 110660851Help
Entry
110660851         CDS       T05150                                 

Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00480  Glutathione metabolism
hbr00590  Arachidonic acid metabolism
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110660851
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110660851
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110660851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 110660851
NCBI-ProteinID: XP_021674981
Position
Unknown
AA seq 170 aa AA seqDB search
MASQLPKYPESVYDFTIKDANGNDVDLSIFKGKVLLIVNVASKCGLTNSNYTELNQLYEK
CKDQGLEILAFPCNQFGEQEPGSNDEIQEFVCTRFKSEFPVFGKVEVNGENGFPLYKFLK
SGKWGIFGDDIQWNFAKFLVNKDGQVVDRYYPTTSPLSLEHDIKKLMGIS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccagcttcctaagtaccctgaatcagtctatgacttcactatcaaggatgct
aatggaaatgatgtagatcttagcattttcaagggaaaagtcttattaattgttaatgtt
gcttctaaatgtggattgaccaactcaaattacacagagctgaatcagttatatgagaag
tgcaaagaccaaggccttgaaatattggcatttccatgcaatcaatttggtgagcaggaa
ccaggaagtaacgatgagattcaagaatttgtctgcactcgctttaaatcagaatttcca
gtatttggcaaggtggaagtgaatggtgagaatggttttccactgtacaagttcttaaag
tcaggcaaatggggaatttttggtgatgatattcaatggaactttgccaaattccttgtc
aataaggacgggcaagtagttgatcgttactaccccacaacttctcctctaagtctcgag
catgacataaagaagctaatggggatctcatga

DBGET integrated database retrieval system