KEGG   Hevea brasiliensis (rubber tree): 110662165Help
Entry
110662165         CDS       T05150                                 

Definition
(RefSeq) probable terpene synthase 3
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110662165
Enzymes [BR:hbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110662165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth ANTAR
Motif
Other DBs
NCBI-GeneID: 110662165
NCBI-ProteinID: XP_021676741
Position
Unknown
AA seq 546 aa AA seqDB search
MSLPAATQRAQVRRTAQFHPTVWGDYFIKRVSDNQMASVWTEQAKILKEEVRRMLTSATD
HKASEKLKLLDAIQRLGISYHFEGEIEEALKKIYQDFEDDGNLCTVALRFRLLRQQGYHV
SSDVFSKFKDGEGNFKEDLINDVHGLLSLYEASYLSVQGEDILDEALEFTKTHLIMATQF
GSPLADQVSHALRWPIRRGLPRKESRDYFSIYQQDEADIKPLLKLAKLDYNIVQMLHQKD
MNMITKWWIDLDFTTKLPFARDRVIECSFWALGTFSEPQYVFAREVLSKAVAMLSVMDDI
YDVHGTIEELELFTKVVESWDISMKDQLPDYMKAYLEAFLDFYAEIEAVTTKEGRPFCIH
YAKEAVKKQVRAYITEARWFNSDYVPTLEEYISVAVISSTYPILITLSFCGMGEVASKEV
FDWLFTEPKLLYAASGLARLIDDIRSHEFEQERGHVASAVECYMKQHGVSQQEAYDELYK
IVINLWKDLNEELLKETADIPKPILMCILNIVRVMDVVYKDEDSYTNSKTSLKDILATFL
VNPVAV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttccagctgcaacccaaagagctcaagttcgccgaacagcacagtttcatcca
accgtctggggtgactacttcatcaagcgcgtatccgataatcagatggcaagtgtttgg
actgaacaagccaagattctgaaagaagaagtgaggaggatgcttacctctgctactgat
cataaagcttcagaaaagctgaagttgctagatgctattcaacgacttgggatttcttac
cattttgaaggagaaatagaagaagcattgaaaaaaatttatcaagactttgaagatgac
gggaacctctgtactgtggctcttcgatttcgccttctaagacagcagggctatcacgtt
tcatctgatgttttcagcaagttcaaggatggggaaggtaactttaaggaagatttaatc
aatgatgtgcatggcttgttaagcttgtatgaagcttcatatctcagtgtgcaaggagaa
gatatactagatgaagctcttgaattcaccaaaactcacctaataatggcaacccaattt
ggttctcctcttgctgaccaagttagccatgctttaaggtggcctatacgcagaggatta
ccaaggaaagagtcaagggattatttctctatttaccagcaagacgaggcagatattaaa
cctttactgaagctggcaaagttggattacaatatagtgcagatgttgcatcaaaaagac
atgaacatgatcacaaagtggtggatagatttggacttcacaaccaaactacctttcgct
cgagacagagtgatcgaatgctctttctgggcattaggaacgttttctgagccacaatat
gtttttgcgagagaagtattgtctaaagctgttgctatgctgtctgttatggatgatata
tatgatgtgcatggtacgattgaagaactagagctattcaccaaagtggttgagagttgg
gatattagcatgaaagatcaacttccggattacatgaaggcgtatttagaagcattttta
gatttctatgctgaaatagaggcagtaactacaaaggaagggaggccattctgcattcac
tacgcaaaggaagcggtgaagaagcaagtgagagcttatatcactgaagcaagatggttc
aacagtgattatgtgccaacattagaagaatatatttctgttgcagtgatcagctctact
taccctatcttgataaccttatccttctgtgggatgggcgaagtggcttcaaaagaggtc
tttgattggcttttcactgaacctaaacttttatatgctgcatcaggtcttgccaggctc
atagatgacatcaggtcccatgagtttgagcaagaaaggggacatgttgcttcagctgtg
gaatgctatatgaagcaacatggcgtatcacagcaggaggcatatgatgagttatacaaa
atagtcataaatttgtggaaagacctcaacgaggagctcctgaaagaaactgcagatatt
ccaaagcctattttgatgtgtattctgaacattgtaagggtcatggatgttgtttacaaa
gatgaagatagttatacaaactccaagacttcactcaaggatatcctggctactttccta
gtcaatcctgtagctgtttaa

DBGET integrated database retrieval system