KEGG   Hevea brasiliensis (rubber tree): 110663703
Entry
110663703         CDS       T05150                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00100  Steroid biosynthesis
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
Module
hbr_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110663703
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110663703
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 110663703
NCBI-ProteinID: XP_021678792
Position
Unknown
AA seq 388 aa
MSRKQSKYLKHQTHSTGKIMDLGFLLHALIPSLNSVYVLVVFFGYLAIAGSILPGKVVPG
VTLQDGSRLCYRCNGLLSLLLLVALLGVGAKMDLLSPTVISESGFELLSTTFILSVLVTL
VLYAAGCNSQNQGSSLKPHVTGNLIHDWWFGIQLNPQFVGIDLKFFFVRAGMMGWLFINL
SVLAKSIQDANLSCSMILYQLFCALYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWI
PFTFSIQGWWLLGNKVELTTAAVVANCLVFLIGYLVFRGANKQKHVFKKNPKALIWGKPP
RVIGGKLLASGYWGIARHCNYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRD
EARCAEKYKEVWAEYRRLVPWRILPYFY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgagtagaaagcagagcaaatatctgaagcatcaaactcactcaactggtaaaataatg
gatctgggatttcttctacacgcgcttattccctcattgaactcggtttatgtactagtc
gtattctttggttatctggcaattgctggatcaatactccctggaaaagttgttcctgga
gttaccctgcaggatggttctcgtctttgttatcgttgcaatgggttgttgtcattgctg
ttgctggttgctcttcttggggttggagctaagatggatcttttatcacccactgtgata
tcagagagcggatttgagctgctatcaacaacctttatactcagtgttcttgtgacgttg
gtactttatgctgctggctgcaattcacaaaaccagggttcttctctgaagcctcatgtc
actggaaacctaatacatgactggtggtttggaatacagctcaatcctcagtttgtgggc
attgacctcaaattcttctttgttagagctggaatgatgggatggctatttataaaccta
tcagttctagcaaaaagtattcaagatgccaacttgagctgttcaatgatcctctaccaa
ctattctgtgcgttatacatcttagattacttcttttatgaggaatacatgacttccaca
tgggatataatagcagagagattgggcttcatgttggtatttggtgatcttgtttggatt
ccttttacttttagcatccagggttggtggcttttgggtaacaaggtggagctaacaaca
gctgctgttgtagcaaattgcttagtttttctgattgggtatctggtctttagaggagct
aacaagcaaaagcatgttttcaaaaagaatccaaaagcactcatatggggtaagccacca
agggttattggaggaaagcttcttgcttctggttattgggggattgcaagacattgtaat
tatcttggagacttgttgttggctctgtccttcagtctaccttgtggaataagttctcct
gttccatacttttatccaatttatctccttattctgctcatttggagagaaagaagagac
gaggctcgctgtgcagagaagtataaagaagtatgggctgagtaccgtagacttgttccc
tggagaattctgccttacttttattaa

DBGET integrated database retrieval system