KEGG   Hevea brasiliensis (rubber tree): 110665739Help
Entry
110665739         CDS       T05150                                 

Definition
(RefSeq) vacuolar-processing enzyme-like
  KO
K01369  legumain [EC:3.4.22.34]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hbr01002]
    110665739
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     110665739
Peptidases and inhibitors [BR:hbr01002]
 Cysteine peptidases
  Family C13: legumain family
   110665739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13
Motif
Other DBs
NCBI-GeneID: 110665739
NCBI-ProteinID: XP_021681678
Position
Unknown
AA seq 396 aa AA seqDB search
MYDDIAFDINNPKPGVRINKPNGNDVYHGVPKDYTGRNCTVDNFFAVILGNKSALTGGNG
KVVDSALDDHIFIYYSDHGSAGIVGMPFGEDLYANDLIDILKKKHDSKTYKKQVFYLEAC
ESGSIFEGLLPNNLSIYAVTAANAVENSWGTYCPGHYPTPPSEHDTCLGDLFSISWMEDS
DLHDLSKETLKKQYQVVRRRTAVDNLDSSHLMQYGDKKLSENPVFVYMGTNPENENSTLT
QYTSSSSRVVNQRNASLLHFWHKYHKAPRGSKEKAEARKKLRDIISHTRHVDRSINQTTT
ILFGEEKTSEVLKMVRPSGQPLVDDWNCLKMLVKAYEKHCGQLTWYGKKYTRAIANMCNA
GVSAEQMMEASIQACFVDNTTAFNVAESIVEKEMDK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgacattgcatttgacataaataatccaaagcctggtgtccgcatcaacaag
cccaatgggaatgatgtttatcatggagttcccaaggattacactggacgcaactgcaca
gttgacaacttttttgctgtgattctgggaaataaatcggctctcactggtggtaatgga
aaagttgtagatagtgctctagacgatcatattttcatatattacagtgaccatggcagt
gcaggtatagttggtatgccttttggtgaggacctttatgccaatgaccttatagacata
ttgaaaaagaagcatgattctaaaacatataaaaagcaggtattctaccttgaagcttgt
gagtctgggagtatttttgagggactacttccaaacaatttaagcatatatgcagttact
gctgcaaatgcagtggagaatagttggggaacgtattgtccaggacattatccaactcct
ccctccgaacatgatacttgcttaggagatttatttagtatttcttggatggaggacagt
gacttgcatgatttaagcaaggaaactctgaagaagcaatatcaagtggttcggagaagg
acagcagtggataacttggatagctctcatttgatgcaatatggagataaaaagctgagt
gagaatccagtctttgtttacatgggcacaaaccctgaaaatgaaaactctactctcact
caatatacttcttcttcctcaagggttgttaatcagcggaatgcaagccttcttcatttt
tggcacaagtatcataaagcccctcgagggtctaaggagaaggctgaagcacgaaagaag
ctacgcgacataatttctcatacaaggcatgtggaccgtagcataaaccagaccacaaca
attttatttggagaggaaaagacctcagaggtgttgaagatggttagaccttctggccaa
cctcttgttgatgattggaattgcctaaaaatgcttgtgaaggcttacgagaaacactgt
ggacagttaacatggtatggaaagaaatatacacgagctattgctaacatgtgcaatgct
ggagtaagtgcggagcaaatgatggaggcatcaatccaagcttgctttgtggataacact
actgctttcaatgtcgcagagagcatcgtcgaaaaggaaatggacaaatga

DBGET integrated database retrieval system