KEGG   Hevea brasiliensis (rubber tree): 110666727Help
Entry
110666727         CDS       T05150                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110666727
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     110666727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 DAO NAD_binding_8 EF-hand_7 EF-hand_8 NAD_binding_7 LysR_substrate p25-alpha EF-hand_10 DUF1858
Motif
Other DBs
NCBI-GeneID: 110666727
NCBI-ProteinID: XP_021683015
Position
Unknown
AA seq 583 aa AA seqDB search
MRGLSLFERASRSFHDYPLLSKFIVVCAVSGGGLLAYADANSSNGVHALAPPEEVSKKKK
VVVLGTGWAGTSFLKKLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIV
RKKNVDISFWEAECFKIDAENKKVYCRCNQNTNMNGKEEFVVDYDYLVIAMGARPNTFNT
PGVMEYCNFLKEVEDAQKIRRTVIDNFEKASLPNLSDEERKRILHFVVVGGGPTGVEFAA
ELHDFVNEDLVKLYPAAKDFVKITLLEAADHILNMFDKRITGFAEEKFKRDGIDVKLGSM
VVKVSDKEISTKVRGNGETTSIPYGMVVWSTGIGTRPVIRDFMKQIGQTNRRALATDEWL
RVEGCNNVYALGDCATINQRKVMEDISAIFKKADKDNSGTLTVKEFQEVIDDICERYPQV
ELYLKNKKMRDIVDMLKEAKGDVAKESIELNINEFKTALSEVDSQMKNLPATAQVASQQG
TYLANCFNRMEEAEKNPEGPLRFRGEGRHRFRPFRYKHLGQFAPLGGEQTAAQLPGDWVS
IGHSSQWLWYSVYASKQVSWRTRALVVSDWTRRFIFGRDSSGI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtttaagcttgttcgagagagcttctagatcctttcatgactatcctttgctc
tctaagtttattgtggtctgcgccgtcagtggtgggggccttttagcctatgctgatgca
aactcatccaatggtgtacatgctttggcaccacccgaggaggtaagcaagaaaaagaag
gttgttgtgcttggaactggttgggcaggaacaagttttttgaagaaactaaataaccct
tcatatgatgtacaagtgatatcgcctcgcaactacttcgctttcactcccctgctacca
agtgttacatgtggtacagtggaagctcgcagcattgttgaacctgttcgtaacattgtt
aggaagaaaaatgtggacattagtttctgggaagctgaatgtttcaagattgatgcagaa
aacaaaaaagtttattgtagatgtaatcaaaatacaaatatgaatgggaaagaagaattt
gtcgtagactatgactaccttgtaatagccatgggagctcgcccaaatacatttaacacg
cctggagtgatggaatattgcaatttcttgaaggaggttgaagacgcacagaagatccgt
aggactgttattgacaactttgaaaaggccagtctaccaaatttaagcgatgaagagaga
aagagaattcttcattttgtggtggttggtggtggtccaaccggtgtggagtttgctgca
gagcttcatgatttcgtcaatgaggatttagtcaaactatatcctgcagccaaagatttt
gtaaaaataacacttcttgaggcagcagatcatattctgaacatgtttgacaaaagaatc
acggggtttgctgaagagaagttcaaaagagacggcattgatgtgaaactagggtcaatg
gttgtgaaagtatctgataaagaaatttctactaaagtaagggggaatggagaaactacg
tctattccttatggaatggttgtctggtcaactggaattggaactcgtcctgtcataagg
gattttatgaagcaaattggtcagactaacaggcgtgctctagcaactgatgagtggctg
cgagttgagggatgtaataacgtatatgcgcttggtgattgtgcaacaattaaccagcgc
aaagtcatggaagatatctcagcaatatttaagaaggcagacaaggacaattctggaaca
ctcacagtaaaagaatttcaggaagttattgatgacatctgtgaaagatatccccaagtg
gaactttatttaaagaacaaaaaaatgcgcgatattgttgatatgctgaaggaagccaaa
ggggatgttgcaaaagaatccattgaactaaatatcaatgagtttaaaacagctctttct
gaagtggattctcagatgaagaatcttccagcaacagcgcaggttgcatctcaacaaggt
acgtaccttgccaattgcttcaaccgcatggaggaggctgagaaaaacccagaaggccct
ctcaggtttaggggagaaggccgccatcggtttcgccctttcaggtacaagcatcttggg
caatttgctccattgggaggagagcaaacggcagcacaacttcctggtgattgggtttca
ataggacatagcagtcagtggctttggtattctgtctacgctagcaagcaagttagctgg
cgaacaagggcattggtggtatctgactggacaaggcgtttcatctttggaagggattcc
agtggaatttga

DBGET integrated database retrieval system