KEGG   Hevea brasiliensis (rubber tree): 110669325Help
Entry
110669325         CDS       T05150                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3
Organism
hbr  Hevea brasiliensis (rubber tree)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PAN_2 S_locus_glycop APH PAN_3 PIP49_C cEGF Kinase-like
Motif
Other DBs
NCBI-GeneID: 110669325
NCBI-ProteinID: XP_021686637
Position
Unknown
AA seq 641 aa AA seqDB search
MKTDGNLVLRPIGLPTDFPYPAYYKSNTDGADEMNSDYRMVFNESGDLNVFVRNGSVVNL
TKSRTKSTGDYFYRATLEADGIFALYAHPRTQADGIFALYAHPRTQTNGSWGQTWYAIWS
VPNDICSDMDTGIATDLGGGPCGYNSYCKLDEKRRPFCECLPGFSLSDPNNKLNGCKQNR
IPNCQQDNTKPEDLYVMQELPNAYWPVSANYEQLQGLHEDDCRRLCLSDCNCMVAVIKEG
TCWKKKLPLSKGRLDYNTYGKALIKVSKSDASSDEPSVGNSNVEKKDRTTLILVGAVFLG
SSVFLNFLLVAAITLFVFYSYKNRLNRTKTSNILETNQRTFTYRDLEEATDGFKEELGRG
AFGTVYKGVLISSSSKTYVAVKKLDRMVQEGEKEFKTEVSAIAKTHHKNLVRLVGFCDEG
SNKLLVYEFMSNGTLASFLFGISRPDWNKRLQMAFGIARGLTYLHEECSTQIIHCDIKPQ
NILLDDSFTARISDFGLAKLLMSDQTRTHTAIRGTRGYVAPEWFRNMPITAKVDVYSYGV
MLLEIICCRRGLEMESENEEEVILADWAYDCYKVKRLDKLVENDEEARNDIKRVEKLVMV
AIWCIQEDPSLRPSVRTVTQMLEGVVQVSVPPCPSPFSSIC
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatggcaatctggtgctccgtcctattggcttgcccactgattttccttat
ccagcttattacaagagcaatacagatggtgctgatgaaatgaattctgactacagaatg
gtctttaatgagtcaggtgatctcaatgttttcgttaggaatggaagtgttgtcaacctc
acaaaaagcagaacaaaatccacaggagattatttttacagggcaacgcttgaagctgat
ggaatttttgcactatatgctcatccaagaactcaagctgatggaatttttgcactatat
gctcatccaagaactcaaactaatggaagctgggggcagacttggtatgccatctggtca
gtcccaaatgacatttgctctgatatggacactggtatcgccactgatttgggtggtggc
ccctgtggatataacagctactgcaaacttgatgaaaaacgaaggccattttgtgaatgc
cttccagggttttccctctccgatccaaacaataaattgaatggctgcaagcaaaataga
attccaaattgtcagcaagacaatacaaaacctgaggatttgtatgtaatgcaggagcta
ccaaatgcatattggccagtttctgcaaactatgaacaattacaagggctacatgaagat
gattgcaggagattatgcctttctgattgcaactgcatggttgctgtcatcaaggagggg
acctgttggaagaaaaaactgccactttcaaaaggaaggctggattataacacctatggc
aaggctctgatcaaggtaagtaaatctgatgcttcttctgatgaaccttctgttgggaat
tcaaacgtagagaagaaagatagaacaactttgattctggtgggagcggtattcttgggt
agctcagtattccttaatttcctacttgtagcagcaataactctgttcgttttctactcg
tacaaaaacagactgaatagaactaaaacatccaacattttagaaacaaatcaacgcact
ttcacatatagagacctagaagaagccacagatggattcaaggaagagctcggaagaggt
gcttttggcactgtatacaaaggagtgttaatatcctcaagttcaaaaacctatgttgca
gtcaagaagctagacaggatggtgcaagaaggcgagaaggaattcaaaacagaagtaagc
gcaatagccaaaacccatcacaagaatttggttaggttggttggattttgcgatgagggc
tcaaacaagcttttggtgtatgaattcatgagcaatggtaccttggctagcttccttttt
ggaatatcaagacctgactggaacaaacgattgcaaatggcatttgggattgcaagagga
ctcacatacttgcatgaagagtgcagcacacagataatccactgtgacattaaaccccaa
aacattcttctagatgattcatttactgcaaggatctcagactttggattggctaagctt
ctgatgagtgatcaaactcgtacacatacggccattagagggactagaggatatgttgcc
ccagaatggttcaggaacatgccaatcacagcaaaagtagatgtttatagttatggagtg
atgctattagagatcatatgttgtagaaggggccttgaaatggaaagcgagaatgaagaa
gaggtcatactagctgattgggcctatgactgctacaaagtaaaaagattggataaacta
gtggaaaatgatgaggaggcaagaaatgacataaaaagggtagaaaagctagtgatggtg
gcaatatggtgcatccaagaggatccatctctaagaccgtccgtgaggaccgtgacacag
atgcttgaaggtgttgttcaagtttctgtgccaccatgtccttccccatttagttcaatc
tgctga

DBGET integrated database retrieval system