KEGG   Hevea brasiliensis (rubber tree): 110669499Help
Entry
110669499         CDS       T05150                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK8-like isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hbr01001]
    110669499
   01009 Protein phosphatases and associated proteins [BR:hbr01009]
    110669499
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110669499
Protein kinases [BR:hbr01001]
 Serine/threonine kinases: Other
  Wnk family
   110669499
Protein phosphatases and associated proteins [BR:hbr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110669499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110669499
NCBI-ProteinID: XP_021686882
Position
Unknown
AA seq 568 aa AA seqDB search
MDLVSCEDDGEFAEKDPTGRYVRYDEILGRGAFKTVYKAFDEVDGIEVAWNQVRIEDVLQ
SPDQLERLYSEVHLIKSLKHENIMKFYHSWVDDKNKTINMITELFTSGSLRQYRKKHKNV
DVKATKNWARQILRGLQYLHGHNPPIIHRDLKCDNVFVNGNNGEVKIGDLGLAIVMQQPT
ARSVIGTPEFMAPELYEEEYNELVDVYSFGMCMLEMVTCEYPYSECKNPAQIYKKVTLGI
KPASLGKVNDPQLKQFIEKCLVPASMRLSATELLKDPFLATENSKEIVPVSLRIADVMSK
QVNTLQSESHPMDIDSNIKKLSIGSCTKSMDEVLPFSTLELRRFTENNEFRLRGEKNGDN
TISLTLRIVERFGGGVKNIHFTFYLDTDTTFSIAEEMVEQLDLSNEDVAIIAELIDALVM
KVVPCWSPSFVSTSSGEQNDAASKAVSENDFLPLVNVIGQETRESFNSGISAEFHMTIAS
DASTNKPLESSYCTVQLNTADFGMHVDGISKYAKYIKNSENTPPDLKMELDAIDMQYNQC
FQELLRMREEAIENAKKKWITKKKIPVM
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtttcgtgtgaggatgatggtgagtttgcggagaaagacccgactggtcga
tacgttcggtatgatgaaatattggggagaggtgcattcaagactgtatataaagcattc
gatgaagttgatggaattgaagttgcctggaaccaagtgaggattgaagatgtgttgcag
tcacccgaccagctggaaagattatattcagaggttcatctgattaagtcactgaaacat
gaaaatatcatgaaattctatcactcttgggtggatgataagaataagacaatcaatatg
ataacagaacttttcacttcagggagtttgaggcagtaccgcaagaagcataagaatgtt
gatgtcaaggccaccaaaaattgggcaagacagatccttcgaggtttacaatatttgcat
ggtcacaatcctcctatcattcatcgtgatttgaaatgtgacaatgtatttgttaacgga
aacaatggggaagttaaaattggagatcttggactagcaattgtcatgcagcagcctaca
gcccgaagtgttataggtactcctgaattcatggctccagagctctatgaagaggaatac
aatgaacttgttgacgtctattcttttggcatgtgcatgttagaaatggttacctgtgaa
tacccatatagtgaatgcaagaacccagcacaaatatataagaaggttaccttgggtata
aagcctgcttctcttggtaaagtgaatgacccccagcttaagcagttcatagagaagtgt
ctagttccagcatctatgagattgtctgcaacagaactcttgaaagatccattcctagca
actgaaaattctaaggaaattgttcctgtatctctgcggatagcagatgttatgtccaaa
caagtcaacacactgcaatcagaatctcatcccatggatattgacagtaacatcaaaaaa
ctttcaataggttcttgtacaaaaagcatggatgaggttctgcctttctcaactctagaa
ttgcgtaggttcactgagaacaatgagttcaggttaagaggagagaaaaatggtgataat
actatttcattgactctgcgcattgtggaacgatttggtggtggagtaaagaatatccat
tttactttttatcttgatactgatactacattttcaatagctgaagagatggttgaacaa
cttgatttgtcaaatgaagatgtggctatcattgccgagttgattgatgccttggtgatg
aaggttgttccttgctggagtccttcatttgtaagtacatcttctggagaacaaaatgat
gcagcttccaaggcagttagcgaaaatgatttcttgcctttggttaatgtgattggtcaa
gagactcgagaatcattcaattcaggcatatctgctgaatttcatatgacaatcgcctct
gatgccagcactaacaagcccttggaatcttcctactgcactgttcaattgaatacagct
gattttgggatgcatgttgatggtatatctaaatatgctaaatacataaaaaattcagag
aatactcctcctgacctgaagatggagcttgatgccattgatatgcaatataatcagtgc
ttccaagaactcttgaggatgagggaggaagcaatagaaaatgccaaaaagaagtggata
acaaagaagaagatacccgtcatgtga

DBGET integrated database retrieval system