KEGG   Hevea brasiliensis (rubber tree): 110670236Help
Entry
110670236         CDS       T05150                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
Organism
hbr  Hevea brasiliensis (rubber tree)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Hum_adeno_E3A Pkinase_fungal PetG
Motif
Other DBs
NCBI-GeneID: 110670236
NCBI-ProteinID: XP_021687906
Position
Unknown
AA seq 704 aa AA seqDB search
MESSKHLSFCTFIINLIFFNFFPFEVQSSNDSIDFNFNKFSPNMAEIKFEGDAYAEGAGI
QLTKSFDKLRSDSDNVGRATYYKPIHLWDKSGNIADLNTYFSFIINAHGNERRGNGFAFF
LTNNGSKLQPSSGKGHLGLLSYTNVQAPFVAVEFDTFCSPDWDPADGNDHIGIDINSLHS
VSVRNWTWNDVKYAGIIQTWIEYNSSSKNLSVHVTNGYQGSYSRNYSYDLYYIVDFRKIL
SEWVTVGFSAATTIHLFEEHEILTWEFNSTLQSDENLANQTGTQGVRPTAAISRKRENKV
WIWAVLGISGTLISVLSVLGLVWYVCCKKRRRQRENGPGSSNDDFEKENGPRSFSYEELV
LATNNFASERLLGKGGFGKVYIGMLRDNSCVAVKRIITSESHLGLKAYVSEVKAISRLRH
RNLVLLIGWCRNKQELFIIYEFVPNKSLDFHLFNKTCLLTWEKRYGIALGLATALLYLQE
ECEQCVLHRDIKSSNILLDSNFNAKLGDFGLATFVEHGQGSDTSRLIGTDGYVAPEYLLT
SKASKESDVYSFGVVVLEIASGRPALKAAVNENGVKSRVKLVEWAWEQYRRGNTFGAADP
QLDQNYAREEMERLIVVGLSCAHPNHSRRPSIREALDILNAKAPLPKLQLEMLTPENIAS
YDDANVNTFSGSSSLGAGVSEALNSGSSVNPQSLTTASATSNST
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggaatcctccaaacatctgtctttctgcacattcatcatcaacctaatcttctttaac
ttcttccctttcgaagtccaatcttcaaatgactcaatcgattttaacttcaacaaattc
agcccaaatatggctgagattaagtttgagggagacgcatatgccgaaggagcaggcatt
caactcaccaaaagctttgataagctgcgctccgacagtgataacgtcggtcgagccaca
tattacaaaccaattcacctttgggacaagtctgggaatattgctgacctcaatacttat
ttttcgttcattatcaatgcccacggtaatgagcgtagaggcaatggatttgcattcttc
ctcaccaacaatggttctaaacttcagccttcgtcaggaaaaggacatcttggccttttg
agctataccaatgtgcaggctccatttgttgccgtggaatttgacactttctgtagtcct
gattgggatcctgcagatggaaatgatcacataggtattgatatcaactcattgcactct
gtttctgtcagaaactggacatggaatgatgttaagtatgcaggaataattcaaacttgg
attgaatataattctagctcaaaaaatttaagtgttcatgtaactaatggttatcaagga
agttactcgagaaattattcgtatgacctttattacattgtagattttagaaaaatttta
tcagaatgggttacggtaggcttctcagcagccaccaccatacatttgtttgaggagcat
gagatactcacttgggagtttaactcaaccttacaatctgatgaaaatttagccaaccaa
actggtacacaaggggtcaggcccaccgcagccatctcaagaaaaagagagaacaaagta
tggatatgggctgtcctgggtattagtggaactctgatttcggttttgtcagttttgggt
ttggtttggtatgtctgttgcaagaagaggagaagacagagagaaaatgggcctggcagc
tcaaatgacgattttgagaaggagaacggaccgagaagcttttcctacgaggaattggtt
cttgcaaccaataactttgcgagtgaaagactgcttggaaagggaggatttggaaaggta
tatattggtatgttgagagacaattcttgtgttgccgtgaagaggattattacttcagag
tctcatctgggtttaaaagcatatgtctcagaagtgaaagccatcagccgactgaggcac
aggaacttggtcctactcattggctggtgccgcaacaagcaagaacttttcattatctac
gagttcgttccaaataagagcttggatttccatctttttaacaaaacatgcctgttgaca
tgggagaagagatatggtatagctttgggcttggccacggcactgctttacctgcaagaa
gaatgtgaacaatgtgtactccatcgagatatcaagtcaagcaatatcttgctggattct
aacttcaatgctaagcttggtgattttgggctggctacgttcgtcgagcatggccaaggc
tcagacacttcaaggttgatcgggacagacggatatgtagctccggagtatctgctaacc
agcaaggcttctaaagaatcagatgtctatagctttggtgtagttgttctggaaatagca
agtggaaggcctgctttaaaagctgcagttaatgaaaatggtgtaaaaagtcgggtgaaa
ctggtggagtgggcttgggagcagtatcgaagaggaaatacttttggtgcagccgatcca
caactagaccaaaattatgctcgggaggagatggaacgattgattgttgttgggctttct
tgtgctcatccaaatcactctcgtcgtccatcaattagggaagctcttgatatactcaat
gccaaagctccattgcccaaattgcaattagagatgcttacgccagaaaatattgcctct
tatgatgatgccaacgttaatactttttccggatcttcatcccttggtgctggtgtctct
gaggccctcaattcgggctcaagtgtcaaccctcagtccttaaccactgcaagtgcaact
tctaattctacctag

DBGET integrated database retrieval system