KEGG   Hevea brasiliensis (rubber tree): 110670238Help
Entry
110670238         CDS       T05150                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.2-like
Organism
hbr  Hevea brasiliensis (rubber tree)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110670238
NCBI-ProteinID: XP_021687908
Position
Unknown
AA seq 588 aa AA seqDB search
EAGIQLTKSFDKLRSDSDNVGRATYYKPIHLWDKSGNIADFNTYFSFIINAHGNESRGNG
FAFFLTNNGSKLQPSSGHGRLGLLSYTNVQAPFVAVEFDTAWSPDWDPADGNDHIGIDIN
SLHSVYLRNWTWNDVKYAGIIQAWIEYNSSSKNLSVHVTNGYQGSYSRNYSYDLYYIVDF
RKNLSEWVTVGFSAATTIHLFEEHEILPWEFNSTLQSDENLANQTGTQGVRPTADISRKR
ENKVWIWAVLGISGTLISVLSVLGLVWYVCSKKRRRQTENGPGSSNDDFEKENGPRSFSY
EELVLATNNFASERLLGKGGFGRVYIGMLSDNSCVAVKRIITSESHQGLKAYVSEVKAIS
RLRHRNLVLLIGWCRNKQELFIIYEFVPNKSLDFHLFNKTCLLTWEKRYGIALGLATALL
YLQEECEQCVLHRDIKSSNILLDSNFNAKLGDFGLFTFVEHGQGSDTSRLIGTDGYVAPE
YLLTSKASKESDVYSFGVVVLEIASGRPALKAAVNENGVKSRVKLVEWAWEQYRRENTFG
AAHPQLDQNYAREEMERLIVVGLACAHPNHSRRPSIREALDILNAKAP
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gaagcaggcattcaactcaccaaaagctttgataagctgcgctccgacagtgataacgtc
ggtcgagccacatattacaaaccaattcacctttgggacaagtctgggaatattgctgac
ttcaatacttatttttccttcattatcaatgcccacggtaatgagagcagaggcaatgga
tttgcattcttcctcaccaacaatggttctaaacttcagccttcgtcaggacatggacgt
cttggccttttgagctataccaatgtgcaggctccatttgttgccgtggaatttgacact
gcctggagtcctgattgggatcctgcagatggaaatgatcacataggtattgatatcaac
tcattgcactctgtttatctcagaaactggacatggaatgatgttaagtatgcaggaata
attcaagcttggattgaatataattctagctcaaaaaatttaagtgttcatgtaactaat
ggttatcaaggaagttactcgagaaattattcgtatgacctttattacattgtagatttt
agaaaaaatttatcagaatgggttacggtaggcttctcagcagccaccaccatacatttg
tttgaggagcatgagatactcccttgggagtttaactcaaccttacaatctgatgaaaat
ttagccaaccaaactggtacacaaggggtcaggcccaccgcagacatctcaagaaaaaga
gagaacaaagtatggatatgggctgtcttgggcattagtggaactctgatttcggttttg
tcagttttgggtttggtttggtatgtctgttccaagaagaggagaagacagacagaaaat
gggcctggcagctcaaatgacgattttgagaaggagaacggaccgagaagcttttcctac
gaggaattggttcttgcaaccaataactttgcgagtgaaagactgcttggaaagggagga
tttggaagggtatatattggtatgttgagcgacaattcttgtgttgccgtgaagaggatt
attacttcagagtctcatcagggtttaaaagcatatgtctcagaagtgaaagccatcagc
cgattgaggcacaggaacttggtcctacttattggctggtgccgcaacaagcaagaactt
ttcattatctacgagttcgttccaaataagagcttggatttccatctttttaacaaaaca
tgcctgttgacatgggagaagagatatggtatagctttgggcttggccacggcactgctt
tacctgcaagaagaatgtgaacaatgtgtactccatcgagatatcaagtcaagcaatatc
ttgctggattctaacttcaatgctaagcttggtgattttgggctgtttacgttcgtcgag
catggccaaggctcagacacttcaaggttgatcgggacagacggatatgtagctccggag
tatctgctaaccagcaaggcttctaaagaatcagatgtctatagctttggtgtagttgtt
ctggaaatagcaagcggaaggcctgctttaaaagctgcagttaatgaaaatggtgtaaaa
agtcgggtgaaactggtggagtgggcttgggagcagtatcgaagagaaaatacttttggt
gcagcccacccacaactagaccaaaattatgctcgggaggagatggaacgattgattgtt
gttgggcttgcttgtgctcatccaaatcactctcgtcgtccatcaattagggaagctctt
gatatactcaatgccaaagctcca

DBGET integrated database retrieval system