KEGG   Hevea brasiliensis (rubber tree): 110671732Help
Entry
110671732         CDS       T05150                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK15 isoform X1
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110671732
Protein kinases [BR:hbr01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110671732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110671732
NCBI-ProteinID: XP_021689977
Position
Unknown
AA seq 442 aa AA seqDB search
MATQAPNGSKGTIGLRQYTYKELAKATGKFSNQFHLGEGGFGQVFWAFLDDEIRAIKKLR
YLPDVQKEELEHEIRVISSVSHKNLVKLVGYCIDGANGLLVLEYLPNGSLKSHLHGKNIL
DWSKRIDIAKGCVLGLEYLHKHCEPPIIHQDVKSDNILFNKNFEPKLADFGLALYFPDSV
THLSRTIKGTEVYMDPEYSGKISAKSDVYSFGVVLLELITGREPLHEGVKIVDWAKIRIV
QALKGDYKDFVDVRLQTQTYDKGEMEKIIYCAKGCVYNLPEFRPSMREIVRFLEGAKLEK
NLWIEKIDNEMRRSTLNREASSSDIERLEIHKPMIFTYEQLTKATEGFSRKNLLGKGSLG
QVYKGYLINHEVTVKKFSHMPRKQEDAFEKMKAICSSVHHNNLVKLIGYCDEGGNKLLVF
EFVSEDKSLRSHLHGMLFILTY
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaggcacctaacggatcaaagggtacaattgggctgaggcagtatacttat
aaagagctagcaaaagcaactggcaagttctccaaccagttccaccttggcgagggtggt
tttggtcaagtcttttgggctttcctagacgatgaaatccgtgctatcaagaaactaagg
tatcttcccgatgtacagaaagaagaattggagcacgagatcagggtcattagcagtgtc
agtcacaaaaatcttgttaaactggttggatactgcattgacggagccaatggattgctt
gttttagagtatcttcccaatgggtccttgaagtctcatttacatggaaaaaacatttta
gattggtcaaaaagaatcgatatcgccaaaggctgtgtgcttggattagaatatctgcat
aaacactgcgagcccccaatcatacaccaagatgtcaaatcagataatattctttttaat
aagaattttgaaccaaagcttgcagatttcggacttgccttgtactttccggatagtgtt
actcatctttctagaacgattaaaggaactgaagtttatatggatccagaatattctgga
aagatctctgctaagtcagatgtctactctttcggtgtggtgcttctagagttgattacg
gggagagaacctttacatgaaggcgttaaaatcgttgattgggcaaagattcgaattgtg
caggctttgaaaggagattataaggactttgttgatgtcagattgcaaacgcaaacgtat
gataaaggagaaatggaaaaaataatatattgtgccaaaggttgtgtatataaccttcca
gagtttcgtccatcaatgagagagattgttcgatttcttgaaggagctaagcttgaaaag
aatttatggattgagaagattgataacgaaatgcgacgcagtactctaaatagagaagct
tcatcgagtgacattgagaggcttgaaattcacaagccgatgatatttacttatgaacaa
ctaacaaaggcgactgaaggtttctccagaaaaaaccttcttggcaagggtagtttgggt
caagtttataagggatacctaatcaatcatgaggtgacagtcaagaaattttcacatatg
cctcgaaagcaagaagatgcgttcgagaaaatgaaagccatttgtagtagcgtccatcac
aacaatcttgttaagctgattggatactgcgatgaaggaggcaataaactacttgttttt
gagttcgtttcagaggacaaatccttgagatctcatttacatggtatgctctttatctta
acttactaa

DBGET integrated database retrieval system