KEGG   Hevea brasiliensis (rubber tree): 110671879Help
Entry
110671879         CDS       T05150                                 

Definition
(RefSeq) probable serine/threonine-protein kinase At1g54610 isoform X1
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hbr01001]
    110671879
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110671879
    2.7.11.23  [RNA-polymerase]-subunit kinase
     110671879
Protein kinases [BR:hbr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110671879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Seadorna_VP7 FixH
Motif
Other DBs
NCBI-GeneID: 110671879
NCBI-ProteinID: XP_021690183
Position
Unknown
AA seq 578 aa AA seqDB search
MGCVIGKTASGQRRSIAGSPNCGRSSDQPSVTVTEAVNAVRDKKEVKQRQKTRHSGDFQA
DVPTAERRRPRPEPFLRNQQGWPSWLMAVAGDAIGDWTPRRANTFEKLDKIGQGTYSNVY
KARDLITGKIVALKKVRFDNLEPESVKFMAREILVLRRLDHPNVLKLEGLVTSRMSCSLY
LVFEYMDHDLAGLAARHEVKFTEAQVKCYMKQLLCGLEHCHSRGVLHRDIKGSNLLIDNE
GVLKIADFGLATFFDPQRRVPMTSRVVTLWYRPPELLLGATYYGVGVDLWSAGCILAELL
AGKPIMPGRTEVEQLHKIFKLCGSPSEEYWKKSKLPNATLFKPQQPYKSCIAETFKDFPP
CSLTLIETLLSVDPDNRGTATSALNSEFFTTEPYACEPSSLPKYPPSKEMDVKLREEEAR
RQRGLSGKANVVDGARRVRIRDRVGRAIPAPEANAENPSNLDRLRVMTQANAKSKSEKFP
PPHQDAAVGHRIDASHKAPVSFGAPDSSFNSSIFTSKSSASIKSAGASGGPSRRKKTNKE
DPQMAPSRKFMRPFNPSTVGLSMDLLFKGKSEVFGRRR
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgtcatcggcaagacggcgtccgggcagcgccggagcattgccggatctccc
aactgtggccggagctccgaccaaccttccgtcaccgttactgaggctgtaaacgctgtc
agggataagaaggaggtaaagcagaggcaaaagactagacactcgggtgatttccaggcg
gatgttcccacggcagagcgtcggcggccacgcccggagcctttcctgaggaaccagcaa
ggttggccttcgtggttaatggcggtcgccggtgatgcaatcggtgactggactcctcgc
cgggcaaacaccttcgagaagcttgataagattggccaaggaacatatagcaatgtatat
aaagcgagggatctcataacaggaaaaatagtagctttgaagaaagtaaggtttgataat
ttagagccggagagtgtaaaattcatggcaagagagattcttgttttgaggagattagat
caccccaatgtgcttaagcttgagggtttggttacctcaagaatgtcatgtagcctttat
ttggtgtttgaatacatggaccatgatctcgctgggctagcagctcgccatgaagtcaag
tttactgaggctcaggtcaaatgctacatgaaacaacttctatgtggccttgagcattgc
cacagtcgaggtgtcttgcaccgtgatatcaagggttccaatctgcttattgacaatgaa
ggagttctaaaaattgctgattttgggctggctactttctttgaccctcagcgaagggtt
cctatgaccagtcgagttgtcaccctctggtaccgtcctcctgagcttcttcttggggct
acttattatggtgttggtgtcgacctttggagtgctggctgtattttggcagagctactt
gctgggaagccaataatgccaggacgaacagaggttgaacaactgcacaagatatttaag
ttatgtggctccccgtcagaggaatactggaagaaatcaaaactgcctaatgcaacgctt
tttaaacctcagcagccatacaaaagctgtatagctgaaaccttcaaggatttccctcct
tgttctctgaccttaatcgaaactcttctttcagttgaccctgataatcgtggcactgcc
actagtgctctaaatagtgaattctttaccactgaaccttatgcttgtgagccatcaagt
ttgcccaagtatcctcccagcaaagaaatggatgtgaagttgagagaagaggaagcaagg
aggcaaagaggccttagtggaaaagcaaatgttgttgatggtgctagaagagttagaatt
cgtgatcgggtaggcagggcaattccagcacccgaagccaatgcagagaatccatcaaac
ttagatagattgagagtcatgacacaagcaaatgctaagagcaagagtgaaaaatttcca
cctcctcatcaggatgcagcagttgggcatcgtatagatgcatcacataaagcccctgta
tcatttggtgcacctgattcttctttcaactcatcgatattcacttcaaagtcatctgca
tccattaaaagcgctggagccagtgggggcccttccaggaggaagaaaaccaataaggaa
gacccccagatggctccctctcggaagtttatgcgcccgtttaatccatccacagtagga
ctatccatggatctattattcaagggtaaatctgaggtttttggcaggcgcaggtag

DBGET integrated database retrieval system