KEGG   Hevea brasiliensis (rubber tree): 110672655Help
Entry
110672655         CDS       T05150                                 

Definition
(RefSeq) heat shock 70 kDa protein 5
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr03040  Spliceosome
hbr04141  Protein processing in endoplasmic reticulum
hbr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110672655
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110672655
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110672655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hbr01009]
    110672655
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hbr03041]
    110672655
   03009 Ribosome biogenesis [BR:hbr03009]
    110672655
   03110 Chaperones and folding catalysts [BR:hbr03110]
    110672655
   04131 Membrane trafficking [BR:hbr04131]
    110672655
   03051 Proteasome [BR:hbr03051]
    110672655
   03029 Mitochondrial biogenesis [BR:hbr03029]
    110672655
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hbr04147]
    110672655
Protein phosphatases and associated proteins [BR:hbr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110672655
Spliceosome [BR:hbr03041]
 Complex B
  Other components
   Prp19 complex
    110672655
 Complex C
   Prp19-CDC5 complex
    110672655
Ribosome biogenesis [BR:hbr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110672655
Chaperones and folding catalysts [BR:hbr03110]
 Heat shock proteins
  HSP70 / DNAK
   110672655
Membrane trafficking [BR:hbr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110672655
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110672655
Proteasome [BR:hbr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110672655
Mitochondrial biogenesis [BR:hbr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110672655
Exosome [BR:hbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   110672655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Zincin_2
Motif
Other DBs
NCBI-GeneID: 110672655
NCBI-ProteinID: XP_021691174
Position
Unknown
AA seq 655 aa AA seqDB search
MASKSEGKAIGIDLGTTYSCVGVWQIDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPQNTVFDAKRLIGRRFSDPTVQSDMKHWPFKVISGPGDKPMIVVQYKGEEKQFAP
EEISSMVLTKMKEIAEAYLGHTVKNAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEP
TAAAIAYGLDKKGSRTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVAEFKRKHKKDISTNARALRRLRTACERAKRTLSSTTQTTIEIDSLYEGIDFY
ATITRARFEELNMDLFRKCMEPVEKCLRDAKIDKSQVHDIVLVGGSTRIPKVQQLLLDFF
NGKELCKSINPDEAVAYGAAVQAAILTGEGDQKVQDLLLLDVTPLSLGIETAGGVMTVLI
PRNTTIPAKKEQIFSTYSDNQTSVLIQVYEGERARTKDNNLLGTFELKGIPPAPRGVPQI
SVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEEVKK
KVEAKNKLENYAYNMRNTVKDEKIAGKLNPADKQKIEKAIDETIEWLDGNQLAEVDEFED
KLKELEGLCNPIISKMYQGGGGEDVPMGGGAQPGSGYGPSSSGGSGAGPKIEEVD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaaatctgaaggcaaggctattggtattgatcttggtaccacctacagctgc
gtgggcgtgtggcagatcgatcgtgttgagatcattgccaatgaccagggcaacagaacc
actccttcttatgttgccttcactgacaccgagcgtcttattggcgatgcggccaagaac
caagtcgccatgaaccctcaaaacactgtttttgatgccaaacgtctcattggtaggcgc
ttctctgatcctactgtccaaagcgacatgaaacactggcctttcaaggtcatttctggc
cctggtgacaagcctatgatcgtggtgcaatataaaggtgaagagaaacaattcgcgcct
gaagagatttcttctatggttctaaccaagatgaaggagattgctgaggcttatctgggt
cacaccgtgaagaatgctgtcatcactgttcctgcttatttcaatgactcgcaaaggcag
gccaccaaggatgctggtgctattgcagggctaaatgtcatgagaattatcaatgagcct
acggctgcggccattgcttatggtttggacaagaaggggtcgaggactggggagaaaaat
gtgcttattttcgatcttggtggagggactttcgatgtttctcttttaacaatcgaggag
ggtatattcgaagtgaaggctactgctggtgatacccaccttggaggagaggacttcgat
aataggcttgttaaccattttgttgcagagttcaagagaaaacacaagaaggatattagt
accaacgccagagctttgagaaggttgaggactgcttgcgagagggcaaagaggactctg
tcttccaccacacagacgactatcgagatcgattccctctatgaaggtattgatttctat
gccaccattactagagcaagattcgaagaactcaacatggatttgtttagaaagtgtatg
gaacctgtggagaagtgtctacgcgatgcaaagatagataaaagtcaagtccatgatatt
gttcttgttggtgggtcaacaagaattccaaaagttcagcaacttttgctagatttcttc
aacggaaaagaactctgcaagagcataaaccccgacgaggctgttgcgtatggagctgcc
gtccaagctgcaatattaaccggtgaaggagatcagaaagttcaagatttacttcttctg
gatgtcactcctcttagccttggaattgagaccgcaggtggtgtcatgacggtcttgatt
ccaaggaacacaacaatcccagccaagaaagagcaaattttctcaacgtattccgataac
cagaccagtgtgctcattcaagtgtatgaaggtgaaagagctagaaccaaggacaacaat
cttctcggcacatttgagcttaagggcatacctccggctccaagaggtgttccccagatt
agtgtatgcttcgatattgatgcaaatggtatattgaatgtgtctgcggaggataaaact
gcaggagtgaagaacaagattacaatcaccaatgacaagggaagattaagcaaggaagag
attgagagaatggtgcaagaagcagagaagtacaaggcagaggatgaggaagtgaagaag
aaggtggaagccaagaacaagctagagaattacgcttataatatgagaaatacggtgaag
gatgagaaaattgcaggtaaactgaatccagcagacaagcagaagattgagaaggccatt
gatgagacaattgaatggcttgacgggaaccaactggcagaggtggatgaatttgaagac
aaattgaaggaattagagggcttgtgcaatccaattatttcaaagatgtatcaaggtggt
ggtggtgaagatgtgccaatgggcggcggtgctcagcccggaagtgggtatggcccttct
agctctggtggttctggagcagggccaaagattgaagaggtggattga

DBGET integrated database retrieval system