KEGG   Hevea brasiliensis (rubber tree): 110673319Help
Entry
110673319         CDS       T05150                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog isoform X1
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hbr04131]
    110673319
Membrane trafficking [BR:hbr04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    110673319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 ANAPC4_WD40 CENP-B_dimeris
Motif
Other DBs
NCBI-GeneID: 110673319
NCBI-ProteinID: XP_021692114
Position
Unknown
AA seq 943 aa AA seqDB search
MALIPSENGVDGDDEREEDEEDEEEEEEDEEEEEEEPRLKYQRMGGSVPTLLSNDAASCI
AVAERMIALGTLDGTVYILDFIGNEVKEFPAHTAAVNDLSFDIEGEYIGSCSDDGSVVIH
SLFTDEKMKFDYHRPMKAIALDPEYSRKTSRRFVAGGLAGHLYFNWKKWLGYRDQVLHSG
EGPIHAVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPHLVWQDDTLL
VIGWGTSVKIASIRTSENKGTNGTYRQIPTASMNKVDIVASFQTSYYISGIAPFGDSLVV
LAYIPGEEGGEKEFSSTIPSRLQGNAQRPEVRVVTWNNDELATDALPLHGFEHYKAKDYS
LAHSPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLQHGWHEKALAAV
EAGQARSELLDEVGSRYLDHLIVERKYAEAASLCPKLLQGSASAWERWVFHFAHLRQLPV
LVPCMPTENPRLRDTAYEVALVALATNSSFHKDLLSTVKSWPPVIYSALPVISAIEPQLN
ASSMTDALKEALAELYVIDGQYEKACSLYADLMKPDIFEFIEKHNLHDAICEKVVQLMML
DWKRAVSLFIQNKDLISPAEIVSQLLAARNKCDSRYFLHVYLRSLFEANPHAGKDFHDMQ
VELYADYDPKMLLPFLRSSQHYTLEKAYDISVKRDLLREQVFILGRMGSSKKALAVIINK
LGDIEEAVEFVTMQHDDELWEELIKQCLNKPEMVGVLLEHTVGNLDPLYIVNLVPNGLEI
PRLRDCLVKIITDYRTETSLRHGCNDILKADCVNLLVKYYKEARRAVCLSSEGEDARAKS
EGRRDSQVTERAVSMRTTEVKSKTRGDSRCCMCFDPFSIQKVSVIVFFCCHAYHMTCLMD
SMHSVSDQKGSEENDEYEEEDDGDDTHAGVPRLRCILCTTAAS
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggctctcattccgtcggaaaacggcgtcgacggagacgacgagcgggaagaggatgaa
gaagatgaggaggaggaagaagaagatgaggaggaggaggaagaggaacccaggctcaag
tatcagagaatgggaggtagtgttcccacgctactatctaatgatgccgcgtcgtgtatt
gcggtggcggagcgcatgatcgcgcttgggacactcgacggtaccgtttatatcctcgat
ttcattggcaacgaggttaaggaatttcctgctcatactgctgcagttaatgaccttagc
tttgatatagaaggtgaatatataggaagctgttcagatgatgggtctgttgtaatacat
agccttttcaccgatgagaaaatgaagtttgattatcatcgtccaatgaaggctattgct
ttggaccctgaatattctagaaaaacatctagaagatttgtagctggtggtttagctggt
catttgtattttaattggaaaaaatggctgggctatcgagaccaggttttgcactctggt
gaaggtccaatacatgctgtaaagtggagaacaagtctcattgcatgggctaatgatgca
ggcgtgaaagtttatgatgctgccaatgatcagcgaataacattcattgaaagaccgcga
ggaagtccacgtcctgagcttttgctccctcacttagtttggcaggacgataccctgttg
gtaattggctggggaacatctgtgaaaattgcatcaataagaacaagtgagaataaagga
accaatgggacatataggcaaattcctacggctagtatgaacaaggtggatattgtggca
tcttttcaaaccagctattatatttcaggaattgctccttttggtgattctttggttgtt
ctagcttatattcctggagaagaaggtggagagaaggaatttagcagcaccattccatcg
agactgcagggtaatgcacagaggcctgaagtacgtgtagttacatggaataatgatgaa
cttgcaacagatgccctacctttgcatggatttgagcattacaaggcaaaagactattcc
cttgctcattctcctttctcaggaagcagctatgctggtggtcaatgggctgctggtgat
gaaccattgtactacattgtatccccaaaggatgtggttattgcaaaaccaagggatgct
gaagatcacattgcatggcttctacaacatggttggcatgaaaaagctttagcagcagtt
gaagcaggtcaggctcgaagtgaactccttgatgaggtgggatctagatatcttgatcat
ttgattgtggaaaggaaatatgctgaagctgcatctttgtgtcccaaattgttacaagga
tctgcatcagcatgggagaggtgggttttccattttgctcacctccgtcagcttcctgta
ttggttccatgtatgccaacagaaaacccaagactgcgtgatactgcttatgaggttgct
ctagtagcactggcaacaaattcatcttttcataaggatcttttgtcaactgttaaatct
tggccacctgtgatttattctgcattacctgtcatttctgccatagaacctcagctaaac
gcctcttccatgaccgatgcacttaaagaggcattagcagagttatatgtaattgatggc
caatatgagaaagcctgttcactttatgctgatcttatgaaaccagatatatttgaattc
attgaaaaacacaacttacatgatgctatttgtgaaaaggttgtccaattgatgatgctg
gattggaagcgtgccgtatctttgtttatccaaaacaaggacctaatttctccagctgaa
attgtctcacaactgctggctgccagaaataagtgtgattcaagatatttcttgcatgta
tatctccgttcattatttgaggcaaatccacatgctggaaaggattttcatgatatgcag
gtagaactttatgcagattatgatccaaaaatgctacttccttttctccgtagcagccaa
cattacacacttgagaaggcatacgatattagtgtcaaaagagatcttttgagggagcaa
gtcttcatacttggaagaatgggaagctcaaaaaaggccctagctgtcatcataaacaaa
ttaggagatattgaagaggctgtagaatttgtaaccatgcagcatgatgatgaactttgg
gaagaattgattaagcagtgtcttaacaaacctgaaatggtaggagttctgttggagcat
actgttggcaatctcgaccccctatacattgtaaatctggtacctaatggcttggaaatt
cctcgccttagggattgcctagtcaaaattattactgattacagaactgaaacatctctt
agacacgggtgcaatgatattcttaaggctgattgtgtgaacctcttggtcaaatactac
aaggaagcaagacgggcagtttgcttaagtagtgaaggagaggatgcacgggcgaaaagt
gaaggtaggagggattctcaggtaactgagagagcagtaagcatgagaacaacggaggtc
aagtcaaaaacaagaggagattcaagatgttgcatgtgttttgatcccttctctatacaa
aaagtttcagtcattgtattcttttgctgtcatgcttatcacatgacttgtttaatggat
tccatgcatagtgttagtgatcaaaaagggagtgaagaaaatgatgagtatgaagaagaa
gatgatggcgatgatacccatgctggtgttcctagattgcgatgcattttgtgtactact
gctgccagttga

DBGET integrated database retrieval system