KEGG   Hevea brasiliensis (rubber tree): 110673582Help
Entry
110673582         CDS       T05150                                 

Definition
(RefSeq) insulin-degrading enzyme-like 1, peroxisomal
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hbr01002]
    110673582
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     110673582
Peptidases and inhibitors [BR:hbr01002]
 Metallo peptidases
  Family M16: pitrilysin family
   110673582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M RVT_2 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 110673582
NCBI-ProteinID: XP_021692411
Position
Unknown
AA seq 521 aa AA seqDB search
MVFTIKHRANGSIERYKAKLVAKGFTQTYGMDYQETFALVAKMNTIRILLSYLEEEVYVE
ILPRFEDEKTKGKACRLKKALYGLKQSLRAWFDRFNAKWTKSLDDRRSTSGYCPFVGGNL
VTWRSKKRNVTIRSSAEVILTGYNDKLRTLLENVIGKIAKFYVNPDRFAVIKEKLGKDYE
NNKFEQPYGQAMYYCYLLLCDQTWPWMEKLEALPHLEAEDLIKFTPMMLSRAFLECYIAG
NIECSEAESIIQYVEDVFFKGPNPICQPLFQSQHLTNRVIKLESGMSYVYPIKGLNPSNE
NSALVHYIQVHQDEFMLNVKLQLFTLIATQPTFQQLRTVEQLGYITHLTQRNDYGIRGLQ
FIVQSTVKDPGYIDLRVEAFLRLFENKIYEMTDVEFKSNVKALIDTKLEKHKNLWEESGF
YWHEIVVGTLKFDRIECEVAALERLTKQEFVDFFDEYIRIGAPQKRTLSIRVYGSLHSLE
YTSDTGEQAELNKVQIEDIYSFRRSQPLHSSFKGSFGRTKL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggtatttactataaagcatagagcaaatgggtccattgagaggtataaggccaaacta
gtggcaaaaggctttactcagacatatgggatggattatcaggagacttttgcacttgtt
gcaaagatgaatactatcaggatcttactgtcatatttagaagaggaggtatatgtggag
attcttccaagatttgaggatgaaaagacaaaaggaaaagcctgtagattgaagaaggca
ttatatggtctgaagcagtcactaagagcatggtttgacagattcaatgcaaagtggact
aaatctcttgatgataggaggtcaacatcaggttattgtccctttgttggtggaaattta
gtcacttggagaagtaaaaagcggaatgtaacaataagatctagtgcagaggtgattctg
actggttataatgacaaactgaggaccttgctggaaaatgtcattggaaaaattgcaaaa
ttttatgtgaatcctgacaggtttgctgtgattaaggaaaagttgggaaaggactatgaa
aataacaagtttgaacaaccctacgggcaagctatgtactattgctatttattgctatgc
gaccagacatggccatggatggaaaaactagaagctcttcctcatcttgaagctgaagat
cttataaagtttactcccatgatgctctcaagggcattcctagagtgctacatagcaggt
aacattgaatgcagtgaggcagagtccataattcagtatgttgaagatgttttcttcaag
ggtccaaaccctatatgccaacctttattccaatcccagcatttgacaaatagggttatc
aagcttgaaagcggtatgagttatgtctaccctatcaaaggcttgaatccaagtaatgag
aactctgctctagtacattatattcaggttcatcaagatgaatttatgctgaatgtgaaa
cttcagctttttactctaattgcaacgcaaccaaccttccaacagctgagaacagttgaa
caacttgggtacattactcacctcacacagaggaatgattatggtattcgtggattacaa
tttatcgttcaatctacagtaaaggatccggggtatattgatttgagagtcgaggcattc
ctcaggttgtttgaaaataaaatttatgagatgactgatgtggagttcaagagcaatgtt
aaggcattgattgatacgaaacttgagaagcacaagaatttatgggaagaatctggattt
tattggcatgagattgttgttgggactctcaagtttgatcgcatagaatgcgaggttgca
gcactagagcggctcacaaaacaagaatttgttgattttttcgacgaatatataagaatt
ggtgcacctcagaagaggacattgagcatacgtgtttatggcagcctacattcactcgag
tacacatcagatacaggtgagcaagctgagctgaacaaggttcagatagaggatatttat
agtttcagaagatcacaacctcttcacagttctttcaaaggatcctttggtcgtacaaag
ttgtaa

DBGET integrated database retrieval system