KEGG   Hyperthermus butylicus: Hbut_0152Help
Entry
Hbut_0152         CDS       T00468                                 

Definition
(GenBank) Acyl-CoA synthetase (NDP forming)
  KO
K22224  acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00010  Glycolysis / Gluconeogenesis
hbu00620  Pyruvate metabolism
hbu00640  Propanoate metabolism
hbu01100  Metabolic pathways
hbu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0152
   00620 Pyruvate metabolism
    Hbut_0152
   00640 Propanoate metabolism
    Hbut_0152
Enzymes [BR:hbu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Hbut_0152
Lipid biosynthesis proteins [BR:hbu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hbut_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 ATP-grasp_2 CPSase_L_D2 Lipase_GDSL_2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABM80024
UniProt: A2BJ63
Position
136431..137168
Genome map
AA seq 245 aa AA seqDB search
MSELRRKALEIIEQALREGRSKLLEHEALAVAELYGVPVAGYGLARNEDEAVEAAERIGY
PVVLKIVSPDIVHKSDVGGVIVGLEKPEDVKKAYNEIIENVKRHAPNARIVGVLVQKMAP
KGAVEVIVGGLRDPVFGPTIMFGLGGIFVEVFRDVSFRVAPFTERDAEEMINEIKASKIL
KGYRNLPPRDIKALIKVIMAAQKLMVENPEIRELDLNPVLSYPDSAITVDARIIVGREEH
SEEHH
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttacgcagaaaagccctcgagattatcgagcaagccctgcgcgagggccgc
agcaagctcctcgagcatgaagcactagcggtagcagaactctatggcgtacccgtagct
ggctacggcctcgcacgcaacgaagacgaagctgtagaggcagccgaaaggataggctac
ccagtagtcctcaagattgttagcccagacatagtccacaagagtgacgtagggggcgtc
atagtaggcctggaaaaacctgaagacgtaaagaaagcctacaacgagatcatcgagaac
gtaaagaggcatgctcccaacgcgagaatagtaggagtactagtccagaagatggcaccc
aagggtgcggtagaagttatagttggaggtctacgcgacccagtcttcggcccaacaata
atgttcggcctaggtggcatattcgtagaggtgttccgtgatgtaagcttccgcgtggca
cccttcacagagcgcgatgcagaggaaatgataaacgagatcaaagcctcaaagatacta
aagggctacagaaacctgccccccagggacatcaaggcattaatcaaggtgataatggcg
gcacagaagctaatggtggaaaaccctgagatacgagaactagacctaaacccagtccta
agctacccagacagtgcaataacagtggatgcaagaataatagttgggagagaagagcac
agtgaggagcaccactaa

DBGET integrated database retrieval system