KEGG   Hyperthermus butylicus: Hbut_0471Help
Entry
Hbut_0471         CDS       T00468                                 

Definition
(GenBank) putative RNA modification enzyme
  KO
K07398  conserved protein with predicted RNA binding PUA domain
Organism
hbu  Hyperthermus butylicus
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Hbut_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT_C2 PUA
Motif
Other DBs
NCBI-ProteinID: ABM80335
UniProt: A2BK24
Position
complement(451790..452269)
Genome map
AA seq 159 aa AA seqDB search
MIIRRARPEEVVRLRAIADYQFGFPAGDLLIPDNVVVGVSPATRRIREIYGEEGLLAVLR
AHDYLYSLSLLGAKRLLALPEPRLRARLRVETPPSKSINCRIIETIDHDLRPGDEVIVLN
SSGELVGVGRLRLSPTEILENECWGEAIRLRKTVKGDNS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
ttgatcattaggcgtgcacggcccgaagaggttgttaggcttagagcaatcgcagactat
cagtttggctttcctgcaggcgacctattaatcccggataatgtggttgtaggtgtttcc
cctgcaacgcgccgtataagggagatttacggcgaggaggggctgctggctgtcctccgt
gcacatgattacttgtactctctctcgctattaggcgccaagaggttgctagctcttccc
gagcctcgtctccgcgcaaggcttcgtgttgaaacacctccctccaagagcattaattgt
agaattatagaaactattgatcatgatctccggcccggcgatgaggttatcgtgttaaac
tctagtggcgagcttgtaggtgtcggcagactaagattatcgccgacggaaatacttgag
aacgagtgttggggtgaggctattaggcttaggaaaactgttaagggggataattcctag

DBGET integrated database retrieval system