KEGG   Hyperthermus butylicus: Hbut_0480Help
Entry
Hbut_0480         CDS       T00468                                 

Definition
(GenBank) predicted nucleotide kinase
  KO
K18532  adenylate kinase [EC:2.7.4.3]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00230  Purine metabolism
hbu01100  Metabolic pathways
hbu01110  Biosynthesis of secondary metabolites
hbu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Hbut_0480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hbu03009]
    Hbut_0480
Enzymes [BR:hbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     Hbut_0480
Ribosome biogenesis [BR:hbu03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    Hbut_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 AAA_22 AAA_33 SKI DUF2075 AAA Mg_chelatase AAA_5
Motif
Other DBs
NCBI-ProteinID: ABM80342
UniProt: A2BK31
Position
complement(457046..457648)
Genome map
AA seq 200 aa AA seqDB search
MERGLLVIAGTPGAGKSVLGSRLARLLKLRFTTISWLVLYNGLWVEYDAQRRSFVIDYEG
LLKLLTGLRGYIVETHWLEPFEELGREHVEFIVVVRCNPLILLERLKRRGWPARKIIENV
EAELVGVIASEARSLLDKGIPVFEVVTSNTTPDKLALEVLEAIRLRKTRCCIDWLSVLRE
EELSRLISSLEELGGEVGSR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttggagcgtgggctactcgttatcgctggcacacctggcgctggtaagagtgttttaggg
tccaggcttgctagactcctcaagctaagattcacaactatctcatggcttgtattgtat
aatgggttatgggttgagtatgatgctcagcgtaggagcttcgtaatagactatgagggt
ttgctgaagctgcttacagggctcagaggctatattgttgagactcactggctagagcct
ttcgaggagctgggaagagagcatgtagagtttattgttgttgttaggtgtaacccgctc
atactccttgaaaggcttaagcgtagaggttggccagcaagaaagataattgagaatgtt
gaggcggagcttgtaggggttatagcttcagaggcacgtagcctactagacaagggcatc
ccggtattcgaggttgtaacctctaatacaacgccagataagctggcgttggaggtgctt
gaagccattaggttgaggaaaacaaggtgctgtatcgactggctaagtgtgctccgtgag
gaagagcttagcaggcttatttccagtctagaggaactaggaggagaggtgggtagccgg
tga

DBGET integrated database retrieval system