KEGG   Hyperthermus butylicus: Hbut_0481Help
Entry
Hbut_0481         CDS       T00468                                 

Definition
(GenBank) Thermosome beta subunit
  KO
K22447  archaeal chaperonin
Organism
hbu  Hyperthermus butylicus
Brite
Chaperones and folding catalysts [BR:hbu03110]
 Heat shock proteins
  HSP60 / Chaperonin
   Hbut_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 Dak2 Telomere_reg-2
Motif
Other DBs
NCBI-ProteinID: ABM80343
UniProt: A2BK32
Position
complement(457800..459506)
Genome map
AA seq 568 aa AA seqDB search
MSARQVAALEPTGVPVLILKEGTQRTYGREALRTNIMIVRAIAETLRTTYGPKGMDKMLV
DSLGDITITNDGATILDKMDVQHPTAKLVVQIAKGQDEEVGDGTKTAVIFAGELLRYAEE
LLDKNVHPTIIVSGYKKAAEEAVKKLHEIAEPIDINDEETLKKIAMTSLTSKAVHGAREH
LAEIVVKAVRQVAEKRGDKWYIDLDAIQIIKKHGGSLRDTKLIYGIVLDKEVVHPGMPKK
VENAYIVLLDAPLEVEKPEIDAEIRINDPAFLKKFLEEEEKILEEMVNKIYNVAMERIRK
DGMEGKAGIVVITQKGIDEVAQHFLAKKGIMAVRRVKRSDIEKIARATGAKIVSNIDDLT
PEDLGFAKLVEERKVGEDKMVFIEGCPNPRAVTILIRGGLERLVDEAERSINDALHAVAD
AIRDGKIVAGGGAVEVEVAKYLREIAPKIGGKEQLAVEAFARALEGLPMALAENAGLEPV
EIIMKLRAAHAKAEGKWVGVNVFKGDVDDMKKLGVIEPVSVKANAIKAGTEAATMVLRID
DIIAAARREEKEEEKKKGEEEEKEEKEE
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacgccaggttgctgcccttgagcctactggtgtaccagtactaatactcaag
gagggcacccagaggacctacggccgtgaagcactaagaacaaacataatgatcgtacgc
gctatcgccgagacgctaaggacaacctacggtcccaagggcatggacaagatgctagtg
gacagccttggcgacataacgataaccaacgacggtgcaacaatcctagacaagatggac
gtacagcacccaacagcgaagctcgtagtgcagattgccaagggtcaggacgaggaggta
ggtgacggtacaaagacagcagtaatattcgctggtgagctactacgttacgccgaggag
ctactagacaagaacgtacacccaacaatcattgtgagtggctacaagaaggcagccgag
gaggcggtaaagaagctccacgagatagctgaacccatagacataaacgacgaggagacc
ctcaagaagatagcaatgacaagcctcacaagcaaggcagtccacggtgcacgcgagcat
ctagcagagatagtcgtcaaggctgtaaggcaggttgctgagaagaggggcgacaaatgg
tacatagacctagatgcgatacagataatcaagaagcatggtggtagcctacgcgacacc
aagctaatctacggcatcgtcctggacaaggaggttgtacacccaggcatgcccaagaag
gtcgagaacgcctacattgtactcctcgatgctccactagaggtcgagaagccagaaatc
gatgcagagataaggatcaacgatccagcattcctcaagaagttcctagaagaggaggag
aagatactagaagagatggtaaacaagatctataacgttgccatggagaggatacgcaag
gacggtatggagggtaaggctggtatcgtagttataacccagaagggtattgacgaggtt
gcccagcacttcctagcaaagaagggcatcatggcagtaagaagggtaaagaggagcgac
atagagaagattgcaagggcgaccggcgccaagatcgtgagcaacattgatgacttaaca
cccgaggacctaggcttcgccaagctcgtcgaggagaggaaggtcggcgaggacaagatg
gtattcatcgagggctgtccgaacccaagagcagtaaccatactcatccgcggtggtctc
gagaggcttgtagacgaggctgaaaggagcatcaacgacgctctacatgctgtagctgat
gcgattagggatggcaagattgttgctggtggtggcgcggttgaggtagaggttgctaag
tacctgcgcgagatagcaccaaagattggtggtaaggagcagctagcagtagaagccttc
gcgagggctctcgagggcctaccaatggctctagcagagaacgctggcctagaacctgta
gagataatcatgaagctacgtgctgcccatgcaaaggctgagggcaagtgggtaggtgta
aacgtcttcaagggcgatgttgatgacatgaagaagctcggtgtcattgagccggtaagc
gtgaaggctaacgcgatcaaggccggtaccgaggctgcaacaatggtgctaaggattgac
gacatcatagcggctgcacgccgcgaggagaaggaggaagagaagaagaagggcgaggaa
gaggagaaggaggagaaggaggagtaa

DBGET integrated database retrieval system