KEGG   Hyperthermus butylicus: Hbut_0485Help
Entry
Hbut_0485         CDS       T00468                                 

Definition
(GenBank) RNase L inhibitor, ATPase
  KO
K06174  ATP-binding cassette, sub-family E, member 1
Organism
hbu  Hyperthermus butylicus
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hbu03009]
    Hbut_0485
Ribosome biogenesis [BR:hbu03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    Hbut_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 RLI Fer4 Fer4_21 Fer4_10 AAA_16 Fer4_6 AAA AAA_33 AAA_22 MMR_HSR1 RsgA_GTPase Fer4_7 AAA_30 Fer4_9 AAA_29 SbcCD_C Rad17 AAA_23 Fer4_2 AAA_15 Fer4_16 AAA_18 NACHT AAA_24 TsaE KAP_NTPase RuvB_N Fer4_4
Motif
Other DBs
NCBI-ProteinID: ABM80347
UniProt: A2BK36
Position
461576..463417
Genome map
AA seq 613 aa AA seqDB search
MARIAVIDYELCKPSKCHRECIAFCPVNLTGGKAIEFDEARRKPVIYEETCVGCGICVKK
CPFKAISIVNLPDELEKSVIHRYGRNGFKLYGLPVPREGRILGIIGKNGTGKSTALRILS
GELRPNLGQVDGTTPSWDEVIRRFRGTELQNYFKKLAEGSIKAAHKIQYIDLVPRRVKGT
VRQLLEKADERGIWRELVKELGLEKVLDRDIRQLSGGELQRFMVAAVLSKDATLYLFDEP
SSYLDVRERVRVARTIRSYAPNNSYLVVVEHDIAMLDYLSDYVVIMYGEPGVYGIASKPY
GVRAGINHFLRGYLPAENMRIRSEPIRYTITATPSETTLSLKTYISWSKLTVSLNGFQLR
VEEGELHEGEVLGVVGPNGIGKTTFVRVLAGELKPTEGSVSKPAGTLKVSYKPQYVSPSL
FGEDKTVEEVLAEANKSVLAPGSWLNVEILRRMRLDRLLDRRVGELSGGELQKLAVAVAL
AREADIYLLDEPSAYLDVEERLAVAKIIKRLTEARGAAAIVVEHDIAVQDYIASRIMVFT
GTPGVEGHAHQPASLFDGMNTFLKELGITIRKDPETGRPRINKEGSFLDRLQKRLGKYYY
IPRPGEEEKEGEE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagaatagctgttatcgactatgaactctgcaagcccagtaagtgccaccgcgag
tgcatagcattctgccctgtaaacctgacaggcggcaaggcgatagagttcgacgaggct
aggaggaagccggtgatctacgaggagacttgcgttggctgcggtatatgtgttaagaag
tgcccgtttaaggctataagcattgttaaccttcccgacgagcttgagaaaagcgtcatc
caccgctatggtaggaacgggtttaagctctatgggctccccgtaccacgtgagggtagg
atacttggcatcataggtaagaatggtactggcaagtctacagcactacgcatcctctcg
ggcgagcttaggccaaacctcggccaggtggatggaaccacaccctcctgggatgaggtt
atccggaggtttagagggacagagcttcaaaactactttaagaagctagccgagggctca
ataaaggcagcccacaagatacagtatatagaccttgtaccccgtcgggttaagggtacc
gtgcgacagctactagaaaaggccgacgagagagggatatggcgggagctggtaaaagag
cttggactcgagaaggttctggaccgagatattaggcagcttagtggtggagagctacaa
cgcttcatggttgcagccgtgctgagcaaggatgcaaccctctacctcttcgacgagcca
agcagctatcttgatgttagggagagggttagggttgccaggacaataaggagctacgcg
ccgaacaacagctatctagtcgtcgtagaacacgacatcgccatgctcgactacctctca
gattacgtcgtaatcatgtatggtgaacccggcgtatacggcatagcctcaaaaccctac
ggcgtccgagccggcataaaccacttcctaaggggctaccttccagccgaaaacatgaga
attagaagcgaaccaataagatacaccataacagccacaccgagcgagaccacactcagc
ttgaaaacatacatctcctggtccaagctaacagtaagcctcaacggcttccagctaagg
gttgaggagggagagctacacgagggagaagtgctaggcgtagtaggaccaaacggtata
ggtaaaacaacctttgtacgtgtactggcaggagagctcaaaccaacggagggtagtgtt
tcaaagcctgccggaaccctaaaggttagctacaagccacagtatgttagcccaagccta
ttcggcgaggataaaaccgttgaggaagtgctcgccgaggccaacaagtctgtgctagca
cccggctcctggctcaacgtggagatacttagaaggatgagactcgaccgcctcctcgat
cgccgtgtaggcgagctaagcggtggagagcttcagaagctagcagtagcagtcgcacta
gcaagagaagctgacatctacctccttgacgaaccctcagcatacctcgacgtggaggag
aggctagcagtagcaaagatcattaagaggctaaccgaagcacgcggtgcagcagcaata
gttgtggagcacgacatagcggtacaagactacattgcaagccggataatggtgttcacc
ggtactcccggcgttgaaggtcatgcacaccaaccagcctcgctcttcgatggcatgaac
acctttctgaaagagctaggcataacgataaggaaggatcctgaaacaggtaggccgagg
ataaacaaggagggaagcttccttgacaggctgcagaagagattaggcaagtactactac
atacctaggccaggcgaggaagagaaagagggagaggaatga

DBGET integrated database retrieval system