KEGG   Hyperthermus butylicus: Hbut_0486Help
Entry
Hbut_0486         CDS       T00468                                 

Definition
(GenBank) hypothetical protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N36 UPF0146
Motif
Other DBs
NCBI-ProteinID: ABM80348
UniProt: A2BK37
Position
463574..464203
Genome map
AA seq 209 aa AA seqDB search
MAPKLPLERRAVRLQAANKVLLPLLSGVKRFSRLWRAYNPLLAGVSRVDQTRDYTVTILT
VHLPASNPLVVALYTSAQESRPITPSQLGQRIARLRAQLAKLRGRVFNAADIVYAILAPR
GFTSGAIKLARRLGVNTARKPEEVIQILAKYLTTRLNRLYLRLKGKLIWGELPLLIYALQ
ELAAALGTKHRVIEPAQALQLAEKGGFLT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttggccccaaagctgccgcttgagagaagggctgtccggcttcaggcagcaaacaaggtg
cttctaccccttctctccggcgtgaaacgattttcccggctctggcgtgcttacaatcca
ctacttgccggggtaagccgggtagaccaaacccgcgactatacagtcacaatcctgacc
gtacacttgccagccagtaacccgctagtagtagcactctacactagcgcacaggaaagc
agaccaataacgccgagccagctagggcagaggattgcaaggctacgagcacaactagcg
aagctgcgcggccgcgtattcaacgctgccgacatagtatacgccatacttgcacctaga
ggcttcacatcaggagcaatcaagctagctaggaggctcggagtaaacactgcaaggaag
cctgaagaagttatacagatacttgcaaaatacctcacaacgaggctgaacaggctatac
ctacgactcaaaggcaaactcatctggggcgagctaccactactcatatatgccctgcag
gaactagcagctgcactaggaaccaagcacagagtcatagagccagcacaagccctccaa
ctcgcagaaaaaggcggattcctaacctga

DBGET integrated database retrieval system