KEGG   Hyperthermus butylicus: Hbut_0488Help
Entry
Hbut_0488         CDS       T00468                                 

Definition
(GenBank) Histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00350  Tyrosine metabolism
hbu00360  Phenylalanine metabolism
hbu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hbu00401  Novobiocin biosynthesis
hbu01100  Metabolic pathways
hbu01110  Biosynthesis of secondary metabolites
hbu01130  Biosynthesis of antibiotics
hbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Hbut_0488
   00350 Tyrosine metabolism
    Hbut_0488
   00360 Phenylalanine metabolism
    Hbut_0488
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbut_0488
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Hbut_0488
Enzymes [BR:hbu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Hbut_0488
Amino acid related enzymes [BR:hbu01007]
 Aminotransferase (transaminase)
  Class II
   Hbut_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C
Motif
Other DBs
NCBI-ProteinID: ABM80350
UniProt: A2BK39
Position
467389..468486
Genome map
AA seq 365 aa AA seqDB search
MTVRIKQWLENVGGGGKSYRDYSGVIARLDLNEPPFPPSTRVIEAVKAEVFNVNRYPEPG
LIRRLVERLAEYSDVDVDNLVIGTGADLILQQTFNTVVEPGSLVVYPYPAFFVYDKIIGL
LGGKPARIDLVDDGDVWKLPLEKLVSALESNDVRLVVIDNPNNPTGSLLLADTAAARRIL
DAASAIGALVVIDEAYYEFSGVTFAKLVDSYDNLVVVRTMSKAFALAGMRIGYAIASRKI
AGILRKLLPPFPPRLSIVAALAALDDIGYSRKLVEWVKHEREWLRIELASIPGVKVYRST
TNFLLVQTPVENVVAKLSEKGVAVRSVPLGSEWMRISVGLHEENQAALEALRGLVVGDTR
QASQA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttaggattaaacagtggcttgaaaatgttggcggtggagggaaaagctaccga
gactatagtggtgttatagctaggcttgatctcaacgagcccccattcccgccttcgaca
cgagtaatagaagctgtaaaggctgaagtttttaatgtcaatcgctacccggagccagga
ctcatacgtaggcttgtagagcgccttgctgagtatagcgatgtagacgttgacaacttg
gtcattgggacgggtgcagatttgattcttcagcaaacgtttaatactgttgttgagcct
ggttccctcgtggtatatccatatccagcattctttgtctatgacaagattataggtttg
cttggcggtaaaccagctcgtatagacctcgtagatgatggtgatgtctggaagctcccg
ctagaaaagcttgtctcagcgctagagagtaatgatgtacgtctagtcgtcatagataat
ccgaataatccaacaggctccctactcctagccgatactgctgcggcaaggaggattctt
gatgcggcctcggctattggcgcccttgtagtcatagacgaggcttactatgagttctcc
ggggttacatttgcaaagcttgtggatagctatgataacctcgtcgtagtacggactatg
agcaaggcctttgccttagctggtatgaggataggctatgcgatagcatcccgtaagata
gctgggattctcagaaaactgcttccgccattccctccgagacttagcatagtagcagca
ctagcagccctcgatgacatagggtatagtaggaagctagtcgagtgggttaagcatgag
agggaatggttaaggatcgagctagcatctataccaggtgtaaaggtgtatcgtagcact
acaaatttcctactagtacagactcccgtggagaatgttgtggcaaagctgtcggagaag
ggtgtggctgtgcgctcggtaccgctaggctccgagtggatgaggatctccgtcggctta
catgaggagaaccaggcggcgctagaggctctccgtggtcttgttgtaggagatacaagg
caagccagtcaagcttga

DBGET integrated database retrieval system