KEGG   Hyperthermus butylicus: Hbut_0505Help
Entry
Hbut_0505         CDS       T00468                                 

Definition
(GenBank) phosphoglycolate phosphatase
  KO
K22223  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00630  Glyoxylate and dicarboxylate metabolism
hbu01100  Metabolic pathways
hbu01110  Biosynthesis of secondary metabolites
hbu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Hbut_0505
Enzymes [BR:hbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     Hbut_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ABM80367
UniProt: A2BK56
Position
488266..489009
Genome map
AA seq 247 aa AA seqDB search
MAEAVRIELPARVCGLALDIDGTLTEKKRLGEFNISLEAVEAVRRAEAAGIPVMLVTGNS
VYVVAGVARYIGASGPHVAENGCIVYDNGTIYRVCRDTARRAARLIEEELAGVLKPSWQN
PCRLHDYAFIPKLLEPGEALEAVKRVLSSRGINVKVGFSGYAIHLRPVDASKGRGLKLAL
KLRGLEPDCVVAVGDSVIDLEMKDAGVILAAVGNADEKLKKNADIVLPGESGRSVKALID
AILSNRG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ttggcggaagcggtgcgcatagagctgccagctagggtttgcgggttagccctagacatt
gatggaactctcactgagaagaaaaggcttggcgaattcaacataagcctagaagctgtt
gaagctgtccgcagggctgaagcagcaggtataccggtcatgcttgttactggcaactct
gtatacgttgttgcaggtgtagcaagatatattggtgcaagtggtccccacgttgctgaa
aatggctgtatagtgtacgataatggtacgatataccgggtttgccgggatactgctcgg
cgtgctgctagacttatagaggaggagctagcaggagtgctaaagccgagctggcaaaac
ccctgcaggctacacgactacgccttcataccaaaacttcttgagcctggcgaggctctt
gaagctgtgaagagggtactcagctctcgcggtataaacgtaaaggtggggtttagcggt
tacgctatacacctacgtccagtggatgccagtaaaggtcgtgggctaaaactagcccta
aagcttaggggtcttgagccagactgtgttgtagctgttggagactcggtaatcgatctt
gagatgaaggatgccggtgtgatcctagcagctgtcgggaatgctgatgagaaactcaag
aagaatgcagatattgttctcccaggagagagtggtaggagtgttaaagcgctcatagat
gctatactttcaaaccgggggtag

DBGET integrated database retrieval system