KEGG   Hyperthermus butylicus: Hbut_0509Help
Entry
Hbut_0509         CDS       T00468                                 

Definition
(GenBank) hypothetical protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM80371
UniProt: A2BK60
Position
complement(491273..492013)
Genome map
AA seq 246 aa AA seqDB search
MVSRLARYIFLVKNLRGVFAVSQSDDAEHYVQWLARRFRYRDVGVSRYLASRLEGIIDKW
LEGNPFHLLDYPSKAAEEAAARVRDVLVGAGLSVEVADSILLSLYYASPILASRTVYEET
KSVGIVVETVYGPKLSQKDAKLHMRIAGYSVLDFLVPITSKAADYIGSTHDIERLSAERL
EAIRADTKRYWRISGKGSEPVIAYIDYLKLLDEAGILSELTSSEGLVLLAIPVLFVLDSV
EGLGAG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccaggcttgcacgctacatatttcttgttaagaatctcaggggagtgtttgcc
gtctcacagtcagacgatgctgaacactatgtacagtggcttgccaggaggttccgctac
agggatgtaggtgtttcgagatatcttgctagcaggttagaaggcattatcgacaagtgg
cttgagggtaacccgtttcacttgctggattacccaagtaaggctgctgaggaagccgct
gcaagggttcgtgacgtgcttgtaggggctggcctcagcgtcgaagtagccgattccata
ctattgtcgctctattatgcctcacccatactggcttcgagaacggtttatgaagagacc
aagagcgtaggcatagttgttgagactgtttatggccccaagctttctcagaaggatgca
aagctacatatgagaatagctggatatagtgtacttgacttcctcgtacctataacatcc
aaggctgcggactacataggctctacacatgatatagagagattgtctgctgagagactc
gaagctatacgagctgatactaagaggtattggaggataagtggtaagggtagcgagccg
gtcatagcatacatagactaccttaaactgctggatgaagccgggattctctccgaactt
actagtagcgaggggctcgtattactggctataccagtgttattcgtactagactccgtg
gaggggctaggagctggctag

DBGET integrated database retrieval system