KEGG   Hyperthermus butylicus: Hbut_0522Help
Entry
Hbut_0522         CDS       T00468                                 

Definition
(GenBank) universally conserved protein
  KO
K09014  Fe-S cluster assembly protein SufB
Organism
hbu  Hyperthermus butylicus
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Hbut_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0051
Motif
Other DBs
NCBI-ProteinID: ABM80384
UniProt: A2BK73
Position
complement(506312..507742)
Genome map
AA seq 476 aa AA seqDB search
MAGVRPAPMRELLEARSVEELLGFQKPYPKEIEIRGRIERSLVEEISRVKKEPDWMRRLR
LRALELFYKLPMPRWVVGIEEIDLEEIAAYVKPKAEKAESWEDLPGWIKEYYTKLGLQEA
VKRMLSGLTAVFDSETVLNLTKKELQEKGVILLPMEEAVQRYPDLVKQYFGRVFPASDHK
FAALHHALWSGGAFVYVPPGIRLTQPIEAFFFIGSELEGQFEHTLLIAGENSYIEFIEGC
AAPMLKKFSFHDGMVEIYAHRGARVHFYTVQNWSRNVINFNNKRAIAEEGAHVEWLEGSI
GSKITYTYPTTILRGRGASTRNVSVAIANGPYIKDTGGKVIHAAPDTRSIIISKSISSNG
GLSIYRGLVRVNRGAYRSVSHVQCDSLILDERSKAYTYPRNEVNEPTAEVTHEASVGRLG
EDQLFYMASRGLSEGEAKAMIVLGFIQSVLRTLPMELFGILSKVIELEFSEYGALG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgtgcgtcccgcacccatgagggagttgcttgaggctcgtagtgttgaggag
ctgctgggcttccagaagccctacccgaaggagatagagatacggggccgtattgagaga
agccttgtagaggaaatatcacgggtcaagaaggagcctgactggatgcgtcgtctccgg
cttcgcgccctagagctattctacaaactacccatgccccgttgggttgttggcatcgag
gagatagacctggaggagatagcggcctatgtgaagcctaaggcggagaaggcggagagc
tgggaggatctcccaggctggataaaggagtactacacgaagctggggctccaagaagcg
gtgaagcggatgctatcgggactcacagctgtcttcgacagcgaaaccgtgctcaacttg
acaaagaaggagctccaggagaagggcgttatactgctcccaatggaggaggctgtgcaa
cgctaccccgacctggttaaacaatactttggccgtgtctttcccgcctccgaccacaag
tttgccgcactacaccacgcattgtggagcggcggcgctttcgtctacgtaccgcctggt
atcaggctcacacagcccatcgaggccttcttcttcataggcagcgagctggagggccag
ttcgagcacacactcctcatagcgggcgagaacagctacatagagttcatagaaggctgt
gccgccccgatgctcaagaagtttagcttccacgacggcatggttgagatctatgctcac
cgtggcgcccgagtgcacttctacaccgtgcagaactggagtaggaatgtcataaatttc
aacaataagcgcgccatagccgaagagggtgcacatgtagagtggttagaggggagcatt
gggagcaagataacctacacatacccaacaaccatactccgcggccgtggagcctcaaca
cgcaacgtctcagtagccatagccaatggcccctacataaaggatacagggggcaaggtg
atacatgccgctcccgatacacgaagcatcataatctcgaagagcatatccagcaatggc
ggcctctccatttaccggggcctggtccgggtaaaccgcggcgcttaccgcagtgtgagc
cacgtgcagtgtgatagcctgatacttgatgagcgtagcaaagcctacacctacccccga
aacgaggtcaacgagcctactgctgaggttacacacgaagctagcgtaggcaggctaggt
gaagaccagctattctacatggctagccgcggcctaagcgagggcgaggctaaggccatg
atagtgctcggcttcatccagagcgtgctccggaccctgcccatggaactattcggcata
ctctccaaggtaatcgaactcgagtttagcgagtacggcgccctaggctaa

DBGET integrated database retrieval system