KEGG   Hyperthermus butylicus: Hbut_0558Help
Entry
Hbut_0558         CDS       T00468                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K02858  3,4-dihydroxy 2-butanone 4-phosphate synthase [EC:4.1.99.12]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00740  Riboflavin metabolism
hbu01100  Metabolic pathways
hbu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Hbut_0558
Enzymes [BR:hbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Hbut_0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: ABM80418
UniProt: A2BKA7
Position
533230..533949
Genome map
AA seq 239 aa AA seqDB search
MGELDKAIEAMRKGIPVLIHDDYGREDEVDYVIHASYVTVDKIYEMRTLAGGLICYAMPL
PAGEMLGLRYIADILAGIEPLGRLAERTLGYGDKPAFSLWVNHLKARTGIRDRDRALTIR
ELDRVVNLIYSGRVEEARKLFYESFMAPGHVPILLGRRLGERRGHTELSLHLAMLAGMTP
STVIVEMLDRGEALSVEEARRVSREKGYPLVEGSEIIAEVERRGEDMYCRYNLCKNRHG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaactagacaaggcaattgaggctatgcggaagggtatccccgtcctaatccac
gatgactatggtagggaggacgaggtagactatgttatccatgcatcctacgtgactgtc
gacaagatatatgagatgagaaccctggcaggcggcctcatatgctacgctatgccgcta
ccagctggtgagatgcttggcctccgctacatagccgacatacttgctggtatcgagcct
cttggcaggcttgcagagcgcaccctaggctacggtgataagcctgccttctcgctatgg
gttaaccatctgaaggccaggacggggatacgggacagggatagggcgctcacaatacgc
gagctggaccgggttgtgaacctcatatattctggcagggttgaggaggcccgtaagcta
ttctacgagagcttcatggcgccaggtcatgtgccgatactgcttggaagaaggctcggg
gagagacgcggtcacaccgagctatccctgcaccttgcaatgcttgccgggatgacaccg
tcaacggttatcgtcgagatgctcgaccgtggcgaggctttgagcgtggaggaggcccgc
agggtatctagggagaagggctaccccctggtggaggggagtgagattatagcagaggtg
gagcgtcgtggtgaagatatgtattgtcgatacaacctttgcaagaatagacatggctag

DBGET integrated database retrieval system