KEGG   Hyperthermus butylicus: Hbut_0564Help
Entry
Hbut_0564         CDS       T00468                                 

Definition
(GenBank) hypothetical protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN
Motif
Other DBs
NCBI-ProteinID: ABM80424
UniProt: A2BKB3
Position
537214..537492
Genome map
AA seq 92 aa AA seqDB search
MLLRRIRLELLADNYIQWLTIYEALNAVWKEAMLLHRLIREEAAGLAEVIAELAGLMRVL
DPRGSELEIVERAHELGLTVYDASYVVLAEKA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgctattaagaaggataaggctggagctgctagcggacaattatatccagtggcttaca
atctatgaggcacttaatgctgtgtggaaggaggcgatgctgcttcacagactgatccgt
gaggaggctgcaggtcttgcagaggttatagcagagttggcagggttaatgcgcgtgcta
gatccacggggcagcgagctagagatagtggagagggcacatgagctaggcttgacagta
tacgacgcatcatatgttgttttagcggaaaaagcataa

DBGET integrated database retrieval system