KEGG   Hyperthermus butylicus: Hbut_0569Help
Entry
Hbut_0569         CDS       T00468                                 

Definition
(GenBank) universally conserved uncharacterized protein family UPF0023
  KO
K14574  ribosome maturation protein SDO1
Organism
hbu  Hyperthermus butylicus
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hbu03009]
    Hbut_0569
Ribosome biogenesis [BR:hbu03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Hbut_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBDS_C SBDS EFG_C
Motif
Other DBs
NCBI-ProteinID: ABM80429
UniProt: A2BKB8
Position
541521..542234
Genome map
AA seq 237 aa AA seqDB search
MPRKGRGEHEPVVARLEVAGKRFEVLVNPDLAFEYKQGKQVSLEDMVISDAVYTDLRRGL
RASPELLRKVFGTDDVVKIAAEIVRRGELQLTAEQRRRLIEAKKKQIISYIARNAIDPKT
KLPIPPARIEAAMEQAGVGVDPFKSVEEQAQLIVKAISRIIPIKIAKALLRIVVPPEYSP
RVAGALQKLGEVKHMDWRTDGSLVAELEIPAGLQQEVIDKLNKLTQGNVDVKIVSVV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggaagggcaggggcgagcacgagcctgtagttgcgaggcttgaggttgcaggt
aagcgtttcgaggttctcgtaaacccggaccttgcttttgagtataagcaagggaagcag
gttagccttgaggacatggttattagcgacgctgtctacactgatctgcgtcgaggcttg
agagcatcacctgaactcctacgcaaggttttcggcactgatgacgtggtaaagattgcg
gctgagattgtacgtcgtggagaactacagctcactgccgagcagaggaggaggctgata
gaggcaaagaagaaacagattataagctacatagcccgcaacgccatagacccgaagacc
aagcttccaattccacccgctaggatagaggctgctatggaacaggcgggcgtaggtgta
gacccgtttaagagtgtagaggagcaagcccagctcatagtcaaggctataagcaggatt
atcccgataaagattgctaaggcgcttctaagaatagttgtgccgcccgagtactcgccg
agagttgctggtgcactgcagaagctgggggaggtaaagcatatggactggaggactgat
gggagcctcgtagcggagctggagatacccgcggggcttcagcaggaggttatagacaag
cttaacaagctcacgcaaggcaatgtggatgttaagattgtgagcgtggtgtag

DBGET integrated database retrieval system