KEGG   Hyperthermus butylicus: Hbut_0571Help
Entry
Hbut_0571         CDS       T00468                                 

Definition
(GenBank) ribonuclease PH
  KO
K11600  exosome complex component RRP41
Organism
hbu  Hyperthermus butylicus
Pathway
hbu03018  RNA degradation
Module
hbu_M00390  Exosome, archaea
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Hbut_0571
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hbu03019]
    Hbut_0571
Messenger RNA biogenesis [BR:hbu03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     Hbut_0571
 Prokaryotic Type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     Hbut_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C
Motif
Other DBs
NCBI-ProteinID: ABM80431
UniProt: A2BKC0
Position
542965..543732
Genome map
AA seq 255 aa AA seqDB search
MAGGAGEKPTLIRWEERDGQKVAIRHDGRLPEQLRPIRMEVGVLSNADGSALVEYGGTRV
IAAVYGPREAHPRHVALPDRAIIRCRYHMAPFSTAERKTPAPTRREVELSKVIREALEAV
VISELYPRTAIDVYMEVLQSDGGTRTAAITAASLALADAGIAMRDLVAGVAVGKVDGVLV
LDIDEIEDNYAEADMPVAMAPSLDKVLLLQLNGVLTHDEFVKALELARKGIQVIYNLQKE
ALRKKYVEVSVEEGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtgccggtgagaaacccacccttataaggtgggaggagcgggacggccag
aaagtagctatccgccatgatggtaggctgccggagcagctccgccccataaggatggag
gttggtgtcctcagcaatgctgatggctcggcgctagtagagtacggaggcaccagggtt
atagcagccgtctatgggcctcgtgaagctcatcccagacatgtagcgctgccagaccgt
gccatcataaggtgccgctaccacatggccccgttctcgacggctgaaaggaagacgcca
gcaccgacaaggcgcgaggttgaactatcaaaggttattcgtgaggcgttggaggctgtt
gttatctccgagctatatcctcgcacagccatcgatgtctacatggaggtgttgcagtcc
gatggcggcacgaggactgctgcgataacagctgcaagcctagcgctagctgatgcaggt
atagctatgagggatctcgttgctggtgttgcagtggggaaagttgatggagtcctggta
ctcgatatagacgaaatcgaggataactatgcagaggcagacatgccggtagcaatggcg
ccgagcctggataaggttctactcctacagcttaacggtgttctaacccatgacgagttt
gtaaaggcgctagagcttgcccggaagggtatacaagtgatctacaacctccagaaggag
gctctccgcaagaagtatgtcgaggtaagtgttgaggagggtgcataa

DBGET integrated database retrieval system