KEGG   Hyperthermus butylicus: Hbut_0574Help
Entry
Hbut_0574         CDS       T00468                                 

Definition
(GenBank) conserved archaeal protein
  KO
K14561  U3 small nucleolar ribonucleoprotein protein IMP4
Organism
hbu  Hyperthermus butylicus
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hbu03009]
    Hbut_0574
Ribosome biogenesis [BR:hbu03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    Hbut_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Brix
Motif
Other DBs
NCBI-ProteinID: ABM80434
UniProt: A2BKC3
Position
545138..545788
Genome map
AA seq 216 aa AA seqDB search
MVLEKRVTSYRILVTTSHRPTQRIRSFVKDLASVLPNAVKINRGKATMRDLYYEAASIGA
NRVVIVAGWKGNPGSINVYEPVEPPDMELKLIARLLLRGVRLSRETPGAQRSYGTSSLGV
YVESGSQELAVLADTLIRAFNAKLILDLERAHRVVDVVAVISPGRDDYVAEIRFLCTGSG
RQCGPLLRLAGVADNVSGYRLHRARAAGGEGAAGSS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggaaaagcgtgtaaccagctataggatcctggtgaccacctctcaccgtcca
acccagcgtataaggagctttgtcaaggacttggcatcggtcctgccaaacgcggttaaa
atcaatcgtggtaaggccactatgcgcgatctatactacgaggcagccagtattggtgca
aaccgcgtcgtcatagttgctggatggaagggtaatccaggctctataaacgtctacgag
cctgtagagccaccagacatggagcttaagcttattgctaggcttttacttagaggcgtt
agattgtcgagggagactcctggagcacaacgctcatatggaacttcgagccttggcgtc
tatgttgaatcaggctcccaggagctagcagtacttgctgacacactgatacgcgcgttt
aacgcgaagcttatactcgaccttgagagagcacatcgtgtcgtggatgttgtagctgtc
atctcgcctggcagggatgactacgtggctgagataaggttcctatgtactggttctggg
cggcagtgtggccccctactgaggctcgcgggggtagcggataatgtatcgggttacagg
ctgcatagagctagagctgccggaggagaaggcgctgcaggcagtagctag

DBGET integrated database retrieval system